Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B164

Protein Details
Accession D4B164    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-84YVIFDVNKRKKQQHRKKKKKLEMEMMKPMLKHydrophilic
NLS Segment(s)
PositionSequence
61-75KRKKQQHRKKKKKLE
Subcellular Location(s) plas 12, mito 8, nucl 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG abe:ARB_02193  -  
Amino Acid Sequences MYHILSSLPPPSVPSICNCPAGLSNSSFAFFFSFLLFIFIYFCFIYDYVTKTAYVIFDVNKRKKQQHRKKKKKLEMEMMKPMLKKITGRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.28
4 0.3
5 0.28
6 0.26
7 0.26
8 0.29
9 0.28
10 0.22
11 0.21
12 0.19
13 0.19
14 0.17
15 0.15
16 0.12
17 0.1
18 0.09
19 0.07
20 0.07
21 0.07
22 0.09
23 0.08
24 0.07
25 0.08
26 0.07
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.09
33 0.09
34 0.11
35 0.1
36 0.11
37 0.11
38 0.1
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.15
45 0.25
46 0.32
47 0.37
48 0.42
49 0.5
50 0.6
51 0.7
52 0.75
53 0.77
54 0.82
55 0.87
56 0.94
57 0.96
58 0.95
59 0.95
60 0.93
61 0.93
62 0.92
63 0.89
64 0.87
65 0.81
66 0.75
67 0.64
68 0.56
69 0.49
70 0.41
71 0.36