Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B0I2

Protein Details
Accession D4B0I2    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AKKSHSPATHRPRRGGLRRRISSBasic
49-72LPQALPHRNNPPHKRRKIGERGEIBasic
NLS Segment(s)
PositionSequence
10-21THRPRRGGLRRR
60-68PHKRRKIGE
157-160IRRK
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004583  DNA_repair_Rad4  
IPR038765  Papain-like_cys_pep_sf  
IPR036985  Transglutaminase-like_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0006289  P:nucleotide-excision repair  
KEGG abe:ARB_01957  -  
Amino Acid Sequences MAKKSHSPATHRPRRGGLRRRISSPGSPENGNNDIPEIYQEMLNESQALPQALPHRNNPPHKRRKIGERGEIKAVEGTNQSEKAKEKTAAMPPQTVYDLDASEEESEPEWEDVSLPGPATTSILPSMLPAGRDIDQEPLQITLGKEAADQGKKGGVIRRKPVTGAEKKLRLEIHKVHVLCLLGHIRLRNTWCNDEETQKKLRRILSKRIIMCLNPKEDLPQFTRSTTFADGLLQSSEAFRRRFRVTGPGMRRPYWLEDCSTAQDPTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.8
4 0.8
5 0.8
6 0.79
7 0.78
8 0.76
9 0.7
10 0.67
11 0.64
12 0.62
13 0.55
14 0.51
15 0.48
16 0.48
17 0.46
18 0.4
19 0.32
20 0.25
21 0.21
22 0.19
23 0.19
24 0.15
25 0.12
26 0.12
27 0.12
28 0.14
29 0.14
30 0.14
31 0.14
32 0.12
33 0.13
34 0.14
35 0.14
36 0.1
37 0.13
38 0.21
39 0.27
40 0.29
41 0.32
42 0.4
43 0.48
44 0.58
45 0.66
46 0.69
47 0.73
48 0.78
49 0.82
50 0.78
51 0.81
52 0.81
53 0.8
54 0.79
55 0.76
56 0.72
57 0.69
58 0.63
59 0.53
60 0.44
61 0.35
62 0.27
63 0.21
64 0.19
65 0.17
66 0.2
67 0.19
68 0.19
69 0.22
70 0.23
71 0.26
72 0.25
73 0.25
74 0.28
75 0.35
76 0.39
77 0.39
78 0.38
79 0.34
80 0.34
81 0.33
82 0.26
83 0.19
84 0.14
85 0.12
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.07
93 0.08
94 0.08
95 0.08
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.08
114 0.07
115 0.07
116 0.07
117 0.09
118 0.09
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.12
125 0.1
126 0.1
127 0.11
128 0.1
129 0.08
130 0.08
131 0.08
132 0.07
133 0.08
134 0.13
135 0.12
136 0.12
137 0.12
138 0.13
139 0.13
140 0.15
141 0.19
142 0.22
143 0.26
144 0.33
145 0.36
146 0.35
147 0.36
148 0.4
149 0.44
150 0.44
151 0.47
152 0.47
153 0.49
154 0.49
155 0.52
156 0.49
157 0.42
158 0.41
159 0.39
160 0.38
161 0.38
162 0.37
163 0.34
164 0.34
165 0.32
166 0.25
167 0.23
168 0.19
169 0.14
170 0.16
171 0.16
172 0.15
173 0.18
174 0.22
175 0.25
176 0.28
177 0.31
178 0.31
179 0.35
180 0.36
181 0.41
182 0.41
183 0.39
184 0.43
185 0.46
186 0.48
187 0.47
188 0.52
189 0.55
190 0.58
191 0.64
192 0.65
193 0.67
194 0.65
195 0.65
196 0.61
197 0.53
198 0.54
199 0.5
200 0.44
201 0.36
202 0.34
203 0.34
204 0.34
205 0.37
206 0.32
207 0.32
208 0.3
209 0.31
210 0.33
211 0.29
212 0.3
213 0.28
214 0.25
215 0.19
216 0.19
217 0.18
218 0.18
219 0.18
220 0.14
221 0.11
222 0.12
223 0.17
224 0.2
225 0.22
226 0.23
227 0.28
228 0.32
229 0.34
230 0.35
231 0.41
232 0.44
233 0.52
234 0.58
235 0.62
236 0.64
237 0.63
238 0.63
239 0.57
240 0.56
241 0.53
242 0.47
243 0.41
244 0.4
245 0.42
246 0.44
247 0.43