Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4ASW3

Protein Details
Accession D4ASW3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MFVKKTSSKPPKIKAKKDIKLKTPSKAHydrophilic
NLS Segment(s)
PositionSequence
5-57KTSSKPPKIKAKKDIKLKTPSKAPLKTDIGPSKATKAVKVGMLKTASKEKEKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
KEGG abe:ARB_07327  -  
Amino Acid Sequences MFVKKTSSKPPKIKAKKDIKLKTPSKAPLKTDIGPSKATKAVKVGMLKTASKEKEKKQAKLSITTATSPPLASTSTSASATTPQSLQNTNNDAHQPKPGSSDLLDKQAKAVQARLKMNHYANRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.87
4 0.88
5 0.87
6 0.85
7 0.85
8 0.8
9 0.77
10 0.74
11 0.74
12 0.72
13 0.69
14 0.64
15 0.61
16 0.62
17 0.57
18 0.58
19 0.54
20 0.48
21 0.45
22 0.43
23 0.38
24 0.37
25 0.35
26 0.27
27 0.24
28 0.23
29 0.24
30 0.26
31 0.24
32 0.23
33 0.25
34 0.25
35 0.24
36 0.29
37 0.27
38 0.31
39 0.36
40 0.36
41 0.44
42 0.5
43 0.53
44 0.53
45 0.58
46 0.54
47 0.54
48 0.51
49 0.45
50 0.39
51 0.35
52 0.28
53 0.22
54 0.2
55 0.14
56 0.12
57 0.09
58 0.08
59 0.08
60 0.09
61 0.09
62 0.11
63 0.11
64 0.11
65 0.11
66 0.13
67 0.13
68 0.13
69 0.12
70 0.13
71 0.15
72 0.17
73 0.18
74 0.21
75 0.23
76 0.23
77 0.24
78 0.27
79 0.26
80 0.25
81 0.3
82 0.27
83 0.24
84 0.28
85 0.27
86 0.25
87 0.24
88 0.31
89 0.27
90 0.34
91 0.35
92 0.3
93 0.31
94 0.31
95 0.33
96 0.27
97 0.31
98 0.28
99 0.35
100 0.41
101 0.44
102 0.45
103 0.49
104 0.54
105 0.55