Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AUD7

Protein Details
Accession D4AUD7    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-57LEAMKWRLSPKSKRSKTEPFCVMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cysk 8, cyto_mito 5.5, nucl 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009006  Ala_racemase/Decarboxylase_C  
IPR022643  De-COase2_C  
IPR022644  De-COase2_N  
IPR000183  Orn/DAP/Arg_de-COase  
IPR002433  Orn_de-COase  
IPR029066  PLP-binding_barrel  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006596  P:polyamine biosynthetic process  
KEGG abe:ARB_07853  -  
Pfam View protein in Pfam  
PF02784  Orn_Arg_deC_N  
PF00278  Orn_DAP_Arg_deC  
CDD cd00622  PLPDE_III_ODC  
Amino Acid Sequences MLYHEPELLKSDMPLNGTIAFWNARKISSTNIAVLEAMKWRLSPKSKRSKTEPFCVMDLGYVHDQYEHWEKTLPGVTPFYELVLAQGIPAARILFANPCKSPSDITFARNTGVNRMTFDNEAELHKIKQLFPESQLILRCFASDPSATYSLSAKFGAHPETSVRLLECAKSLRLNVIGVSFHIGSGARDPNAFEIAIESSRRIFDAGIRIGHSMRLLDIGGGFSESTFEDMAASIQRSLDFHFRDINVELVAEPGRYFAAGAMTIACEIIARRDAKEAPPSAEEASNMLYLNDGVYGTFSSSLFEPSPHPRVLRASGVFYPQPAAGDQVKNILWGPTCDGVDCIAKDVELPERLTFGDWLYFPDMGVSYPCFLAFTDLMPAYSTCLATGFNGFASDREIIYISSNPLTIGFLTKANKIMYKEQTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.19
4 0.19
5 0.18
6 0.17
7 0.18
8 0.16
9 0.21
10 0.2
11 0.2
12 0.23
13 0.24
14 0.27
15 0.31
16 0.34
17 0.31
18 0.31
19 0.31
20 0.28
21 0.27
22 0.23
23 0.19
24 0.18
25 0.15
26 0.15
27 0.17
28 0.25
29 0.34
30 0.42
31 0.49
32 0.59
33 0.67
34 0.74
35 0.8
36 0.83
37 0.81
38 0.81
39 0.79
40 0.71
41 0.64
42 0.57
43 0.49
44 0.39
45 0.32
46 0.27
47 0.21
48 0.18
49 0.16
50 0.15
51 0.15
52 0.18
53 0.25
54 0.22
55 0.2
56 0.22
57 0.22
58 0.27
59 0.32
60 0.28
61 0.23
62 0.24
63 0.24
64 0.24
65 0.24
66 0.2
67 0.16
68 0.14
69 0.12
70 0.12
71 0.11
72 0.07
73 0.09
74 0.08
75 0.08
76 0.09
77 0.08
78 0.06
79 0.07
80 0.08
81 0.13
82 0.17
83 0.22
84 0.22
85 0.24
86 0.26
87 0.27
88 0.28
89 0.24
90 0.28
91 0.26
92 0.28
93 0.3
94 0.29
95 0.29
96 0.3
97 0.28
98 0.26
99 0.27
100 0.25
101 0.23
102 0.24
103 0.26
104 0.23
105 0.23
106 0.19
107 0.17
108 0.18
109 0.19
110 0.18
111 0.16
112 0.19
113 0.2
114 0.19
115 0.23
116 0.26
117 0.25
118 0.26
119 0.31
120 0.29
121 0.3
122 0.33
123 0.28
124 0.26
125 0.24
126 0.21
127 0.16
128 0.16
129 0.15
130 0.12
131 0.13
132 0.15
133 0.17
134 0.16
135 0.16
136 0.18
137 0.16
138 0.17
139 0.16
140 0.12
141 0.12
142 0.14
143 0.16
144 0.15
145 0.14
146 0.14
147 0.16
148 0.17
149 0.16
150 0.14
151 0.12
152 0.13
153 0.13
154 0.13
155 0.12
156 0.13
157 0.13
158 0.14
159 0.14
160 0.14
161 0.14
162 0.12
163 0.12
164 0.11
165 0.09
166 0.11
167 0.09
168 0.08
169 0.08
170 0.08
171 0.07
172 0.1
173 0.12
174 0.1
175 0.1
176 0.1
177 0.11
178 0.12
179 0.11
180 0.08
181 0.07
182 0.08
183 0.09
184 0.09
185 0.08
186 0.08
187 0.08
188 0.08
189 0.08
190 0.07
191 0.08
192 0.13
193 0.15
194 0.15
195 0.16
196 0.16
197 0.16
198 0.17
199 0.14
200 0.09
201 0.07
202 0.07
203 0.06
204 0.05
205 0.05
206 0.05
207 0.04
208 0.05
209 0.04
210 0.03
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.09
226 0.14
227 0.14
228 0.15
229 0.17
230 0.17
231 0.19
232 0.2
233 0.18
234 0.12
235 0.11
236 0.1
237 0.09
238 0.09
239 0.07
240 0.06
241 0.06
242 0.05
243 0.05
244 0.05
245 0.04
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.04
255 0.04
256 0.05
257 0.1
258 0.1
259 0.11
260 0.15
261 0.17
262 0.19
263 0.26
264 0.27
265 0.25
266 0.25
267 0.26
268 0.25
269 0.23
270 0.21
271 0.15
272 0.15
273 0.13
274 0.12
275 0.1
276 0.08
277 0.08
278 0.08
279 0.07
280 0.05
281 0.04
282 0.05
283 0.05
284 0.05
285 0.06
286 0.06
287 0.07
288 0.07
289 0.1
290 0.1
291 0.11
292 0.14
293 0.19
294 0.24
295 0.25
296 0.25
297 0.25
298 0.29
299 0.32
300 0.35
301 0.3
302 0.3
303 0.29
304 0.33
305 0.31
306 0.27
307 0.25
308 0.18
309 0.18
310 0.14
311 0.16
312 0.16
313 0.17
314 0.17
315 0.2
316 0.19
317 0.19
318 0.2
319 0.18
320 0.14
321 0.14
322 0.18
323 0.17
324 0.17
325 0.16
326 0.17
327 0.16
328 0.19
329 0.18
330 0.17
331 0.13
332 0.13
333 0.13
334 0.14
335 0.17
336 0.17
337 0.19
338 0.17
339 0.18
340 0.19
341 0.19
342 0.18
343 0.14
344 0.15
345 0.13
346 0.16
347 0.18
348 0.17
349 0.16
350 0.16
351 0.15
352 0.13
353 0.14
354 0.13
355 0.11
356 0.11
357 0.12
358 0.11
359 0.1
360 0.14
361 0.13
362 0.12
363 0.16
364 0.16
365 0.17
366 0.17
367 0.17
368 0.16
369 0.17
370 0.16
371 0.11
372 0.12
373 0.12
374 0.12
375 0.14
376 0.11
377 0.1
378 0.12
379 0.12
380 0.11
381 0.15
382 0.15
383 0.13
384 0.13
385 0.14
386 0.13
387 0.16
388 0.18
389 0.17
390 0.17
391 0.17
392 0.16
393 0.16
394 0.16
395 0.14
396 0.16
397 0.14
398 0.18
399 0.21
400 0.23
401 0.27
402 0.29
403 0.33
404 0.34
405 0.41