Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4ATW1

Protein Details
Accession D4ATW1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-102ERKDEDEKREMKKKKKKQRGGTKEKVBasic
NLS Segment(s)
PositionSequence
83-102EKREMKKKKKKQRGGTKEKV
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
KEGG abe:ARB_07774  -  
Amino Acid Sequences MAMKWGKVLYDKNETQREVKKEDGKVVYRRKKEEGERGTTHSTKENGRDEGGNKGNRRKLEQNLCIYVGKVFFAKEERKDEDEKREMKKKKKKQRGGTKEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.57
4 0.56
5 0.52
6 0.55
7 0.54
8 0.5
9 0.55
10 0.55
11 0.54
12 0.57
13 0.63
14 0.65
15 0.64
16 0.65
17 0.63
18 0.64
19 0.65
20 0.66
21 0.62
22 0.61
23 0.57
24 0.58
25 0.58
26 0.51
27 0.45
28 0.38
29 0.34
30 0.28
31 0.31
32 0.3
33 0.26
34 0.26
35 0.27
36 0.24
37 0.28
38 0.31
39 0.3
40 0.29
41 0.33
42 0.36
43 0.36
44 0.4
45 0.39
46 0.43
47 0.47
48 0.52
49 0.51
50 0.5
51 0.5
52 0.45
53 0.4
54 0.32
55 0.23
56 0.17
57 0.12
58 0.1
59 0.09
60 0.14
61 0.19
62 0.23
63 0.28
64 0.33
65 0.37
66 0.42
67 0.46
68 0.5
69 0.54
70 0.55
71 0.57
72 0.62
73 0.67
74 0.72
75 0.78
76 0.8
77 0.83
78 0.88
79 0.9
80 0.92
81 0.94
82 0.95