Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AIP9

Protein Details
Accession D4AIP9    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
315-348SMGAKERQKGIERRRKKVASKEKKEMPRSRRIVEBasic
NLS Segment(s)
PositionSequence
90-96KKGAKRK
126-160RERIRRAKEEKASKSERSRDSELLDKKHKEARSSK
242-346RRSKEDDEKARLKKMITSMKDRKRAMENRERERQVLAKHRKKERELIKEGKKEKAWFLKKADLKKEALKEKYESMGAKERQKGIERRRKKVASKEKKEMPRSRRI
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
KEGG abe:ARB_04145  -  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MALSGILNKRVTAYRADENELEDDFSSSEELNTLSSEDDEDEDENDESENEETPDNTSSEDDGDNDIKSSLSQISFGALAKAQQSLGPLKKGAKRKHGSEEEEEEEENNTNTKYKKSKSDALNELRERIRRAKEEKASKSERSRDSELLDKKHKEARSSKHAPAVQSSKYAVSRRRVVVDGENVAQAKSRDPRFDSAVQSYSHGVKSSSYSTSHSDLAAAKNYAFLNEYRDAELKELEEKLRRSKEDDEKARLKKMITSMKDRKRAMENRERERQVLAKHRKKERELIKEGKKEKAWFLKKADLKKEALKEKYESMGAKERQKGIERRRKKVASKEKKEMPRSRRIVEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.42
4 0.4
5 0.39
6 0.39
7 0.34
8 0.3
9 0.22
10 0.19
11 0.14
12 0.14
13 0.12
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.09
20 0.09
21 0.08
22 0.08
23 0.09
24 0.09
25 0.1
26 0.11
27 0.11
28 0.11
29 0.13
30 0.13
31 0.12
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.12
41 0.14
42 0.13
43 0.13
44 0.13
45 0.12
46 0.14
47 0.14
48 0.13
49 0.15
50 0.16
51 0.15
52 0.15
53 0.14
54 0.12
55 0.11
56 0.12
57 0.12
58 0.11
59 0.11
60 0.11
61 0.12
62 0.13
63 0.13
64 0.12
65 0.09
66 0.1
67 0.1
68 0.11
69 0.1
70 0.1
71 0.12
72 0.18
73 0.2
74 0.22
75 0.23
76 0.28
77 0.35
78 0.43
79 0.48
80 0.52
81 0.55
82 0.59
83 0.67
84 0.69
85 0.68
86 0.65
87 0.63
88 0.56
89 0.52
90 0.46
91 0.36
92 0.29
93 0.24
94 0.18
95 0.13
96 0.1
97 0.12
98 0.13
99 0.18
100 0.24
101 0.28
102 0.37
103 0.42
104 0.5
105 0.54
106 0.61
107 0.65
108 0.65
109 0.7
110 0.61
111 0.59
112 0.55
113 0.5
114 0.45
115 0.43
116 0.42
117 0.4
118 0.44
119 0.48
120 0.53
121 0.6
122 0.62
123 0.64
124 0.64
125 0.63
126 0.65
127 0.64
128 0.61
129 0.58
130 0.57
131 0.5
132 0.47
133 0.49
134 0.46
135 0.45
136 0.46
137 0.41
138 0.4
139 0.44
140 0.43
141 0.42
142 0.45
143 0.45
144 0.49
145 0.54
146 0.53
147 0.54
148 0.54
149 0.48
150 0.46
151 0.43
152 0.34
153 0.29
154 0.27
155 0.22
156 0.24
157 0.27
158 0.27
159 0.27
160 0.32
161 0.31
162 0.33
163 0.32
164 0.3
165 0.29
166 0.27
167 0.24
168 0.19
169 0.19
170 0.17
171 0.15
172 0.15
173 0.12
174 0.12
175 0.16
176 0.18
177 0.2
178 0.22
179 0.25
180 0.28
181 0.32
182 0.32
183 0.29
184 0.3
185 0.27
186 0.26
187 0.25
188 0.22
189 0.18
190 0.16
191 0.13
192 0.11
193 0.13
194 0.14
195 0.15
196 0.14
197 0.16
198 0.19
199 0.21
200 0.21
201 0.19
202 0.17
203 0.17
204 0.18
205 0.18
206 0.15
207 0.13
208 0.15
209 0.15
210 0.14
211 0.13
212 0.12
213 0.15
214 0.17
215 0.18
216 0.17
217 0.19
218 0.19
219 0.19
220 0.19
221 0.15
222 0.14
223 0.15
224 0.16
225 0.2
226 0.22
227 0.29
228 0.34
229 0.35
230 0.37
231 0.44
232 0.51
233 0.56
234 0.62
235 0.61
236 0.65
237 0.67
238 0.67
239 0.61
240 0.51
241 0.45
242 0.46
243 0.47
244 0.43
245 0.5
246 0.55
247 0.62
248 0.7
249 0.67
250 0.63
251 0.64
252 0.67
253 0.66
254 0.67
255 0.67
256 0.66
257 0.75
258 0.73
259 0.64
260 0.6
261 0.55
262 0.52
263 0.54
264 0.57
265 0.56
266 0.63
267 0.71
268 0.76
269 0.76
270 0.78
271 0.77
272 0.77
273 0.77
274 0.78
275 0.78
276 0.79
277 0.78
278 0.76
279 0.71
280 0.64
281 0.63
282 0.64
283 0.61
284 0.59
285 0.62
286 0.63
287 0.64
288 0.7
289 0.7
290 0.65
291 0.62
292 0.62
293 0.65
294 0.65
295 0.64
296 0.59
297 0.55
298 0.53
299 0.52
300 0.48
301 0.41
302 0.37
303 0.42
304 0.43
305 0.48
306 0.51
307 0.52
308 0.54
309 0.61
310 0.65
311 0.67
312 0.72
313 0.74
314 0.75
315 0.81
316 0.84
317 0.84
318 0.85
319 0.85
320 0.86
321 0.86
322 0.88
323 0.88
324 0.89
325 0.91
326 0.9
327 0.87
328 0.86
329 0.83