Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B4C0

Protein Details
Accession D4B4C0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-53ASERREVCRLRRQKEDKKKKEKKTKGEKEVPARRLBasic
NLS Segment(s)
PositionSequence
28-51LRRQKEDKKKKEKKTKGEKEVPAR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 2
Family & Domain DBs
KEGG abe:ARB_03309  -  
Amino Acid Sequences MVQLEGRGESQLHPAVCLASERREVCRLRRQKEDKKKKEKKTKGEKEVPARRLLSRQQDVLFMLRILSFSVSIGAFDMGRQSRYGSQERGGSIGLATCYPAASKTLHRQTTEVHTALSRLKSWIQGGFSIKYYDTSGFVLRRGGLVKFRRKGPVEIMPVDIRIKRGLSIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.2
5 0.17
6 0.17
7 0.24
8 0.25
9 0.29
10 0.36
11 0.39
12 0.43
13 0.51
14 0.56
15 0.55
16 0.64
17 0.7
18 0.74
19 0.82
20 0.86
21 0.87
22 0.89
23 0.94
24 0.94
25 0.95
26 0.94
27 0.93
28 0.93
29 0.93
30 0.92
31 0.92
32 0.89
33 0.88
34 0.87
35 0.79
36 0.73
37 0.65
38 0.56
39 0.51
40 0.5
41 0.48
42 0.42
43 0.42
44 0.37
45 0.36
46 0.35
47 0.32
48 0.26
49 0.16
50 0.13
51 0.1
52 0.09
53 0.08
54 0.07
55 0.06
56 0.05
57 0.06
58 0.06
59 0.05
60 0.06
61 0.06
62 0.05
63 0.05
64 0.08
65 0.07
66 0.08
67 0.08
68 0.09
69 0.12
70 0.17
71 0.2
72 0.18
73 0.2
74 0.22
75 0.22
76 0.22
77 0.18
78 0.14
79 0.11
80 0.1
81 0.08
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.07
90 0.11
91 0.2
92 0.28
93 0.32
94 0.33
95 0.34
96 0.35
97 0.41
98 0.42
99 0.33
100 0.26
101 0.22
102 0.23
103 0.25
104 0.24
105 0.18
106 0.15
107 0.16
108 0.17
109 0.19
110 0.21
111 0.19
112 0.21
113 0.24
114 0.23
115 0.23
116 0.22
117 0.21
118 0.19
119 0.2
120 0.17
121 0.15
122 0.15
123 0.18
124 0.18
125 0.18
126 0.19
127 0.17
128 0.18
129 0.18
130 0.18
131 0.23
132 0.31
133 0.4
134 0.44
135 0.48
136 0.55
137 0.57
138 0.59
139 0.58
140 0.58
141 0.55
142 0.52
143 0.52
144 0.45
145 0.44
146 0.43
147 0.37
148 0.3
149 0.26
150 0.25