Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B434

Protein Details
Accession D4B434    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23VDPSWRKPKGIDNRVRRRFSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abe:ARB_03223  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MRVDPSWRKPKGIDNRVRRRFSGQAAMPKIGYGSNKKTRHMIPSGHKVFLVQNPKDVELLLMHNRTYAAEYISPGCLSIKAEVITSLFLRSYLITFSPIRIGHAVSSAKRVDIIAKAKALGVKVTNAKGRLTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.83
4 0.84
5 0.76
6 0.72
7 0.67
8 0.62
9 0.6
10 0.55
11 0.54
12 0.54
13 0.53
14 0.46
15 0.4
16 0.35
17 0.28
18 0.26
19 0.23
20 0.28
21 0.36
22 0.39
23 0.41
24 0.46
25 0.47
26 0.5
27 0.49
28 0.48
29 0.45
30 0.53
31 0.54
32 0.5
33 0.46
34 0.4
35 0.38
36 0.36
37 0.37
38 0.27
39 0.28
40 0.29
41 0.29
42 0.29
43 0.26
44 0.2
45 0.12
46 0.15
47 0.14
48 0.13
49 0.13
50 0.13
51 0.13
52 0.12
53 0.12
54 0.1
55 0.07
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.08
62 0.08
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.1
82 0.11
83 0.12
84 0.16
85 0.16
86 0.17
87 0.17
88 0.17
89 0.14
90 0.19
91 0.22
92 0.18
93 0.23
94 0.21
95 0.2
96 0.2
97 0.2
98 0.17
99 0.21
100 0.25
101 0.23
102 0.24
103 0.24
104 0.25
105 0.27
106 0.25
107 0.22
108 0.19
109 0.21
110 0.26
111 0.3
112 0.34
113 0.34
114 0.34
115 0.34