Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AWE9

Protein Details
Accession D4AWE9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-63TSTPTRYHHRHYHHYHHHHRLEKRBasic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 7, E.R. 4, golg 4
Family & Domain DBs
KEGG abe:ARB_00514  -  
Amino Acid Sequences MRIKMRRSQTPRTYMSFILLVCLCVQWLPVLALPSSGNFTSTPTRYHHRHYHHYHHHHRLEKRVLSPPLPTTEYAKTKMKPGRPHKDKAIFYTAQTLFSGLHLIQRFNGQGISDTDNGEKVMDMEGGPFAESTKLFLNNKDTWNDDEKDIAVGQVSRAFAERAKGIVRVVFPEDYSPHIRPNTWTEYEWPALQENPDVTKVLAWWVKKGGDEPMGDGTEIWPCDMTTDPGRQPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.54
3 0.46
4 0.36
5 0.31
6 0.26
7 0.2
8 0.17
9 0.16
10 0.13
11 0.1
12 0.1
13 0.07
14 0.08
15 0.08
16 0.1
17 0.11
18 0.11
19 0.13
20 0.13
21 0.13
22 0.15
23 0.14
24 0.13
25 0.12
26 0.15
27 0.2
28 0.21
29 0.24
30 0.24
31 0.32
32 0.34
33 0.42
34 0.48
35 0.49
36 0.58
37 0.63
38 0.7
39 0.74
40 0.8
41 0.82
42 0.84
43 0.84
44 0.82
45 0.78
46 0.76
47 0.74
48 0.68
49 0.63
50 0.61
51 0.57
52 0.5
53 0.49
54 0.42
55 0.38
56 0.35
57 0.31
58 0.27
59 0.31
60 0.33
61 0.34
62 0.36
63 0.33
64 0.39
65 0.44
66 0.47
67 0.51
68 0.57
69 0.64
70 0.66
71 0.71
72 0.72
73 0.75
74 0.7
75 0.65
76 0.62
77 0.51
78 0.45
79 0.48
80 0.39
81 0.31
82 0.28
83 0.24
84 0.16
85 0.16
86 0.16
87 0.07
88 0.11
89 0.11
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.12
96 0.07
97 0.08
98 0.1
99 0.13
100 0.12
101 0.13
102 0.13
103 0.13
104 0.13
105 0.11
106 0.09
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.06
120 0.08
121 0.12
122 0.13
123 0.15
124 0.2
125 0.23
126 0.26
127 0.26
128 0.26
129 0.25
130 0.3
131 0.3
132 0.24
133 0.21
134 0.19
135 0.19
136 0.17
137 0.13
138 0.08
139 0.07
140 0.07
141 0.09
142 0.09
143 0.08
144 0.09
145 0.1
146 0.1
147 0.12
148 0.12
149 0.11
150 0.12
151 0.13
152 0.13
153 0.15
154 0.15
155 0.15
156 0.17
157 0.16
158 0.15
159 0.16
160 0.17
161 0.19
162 0.23
163 0.22
164 0.24
165 0.25
166 0.26
167 0.27
168 0.33
169 0.35
170 0.33
171 0.33
172 0.32
173 0.35
174 0.36
175 0.34
176 0.29
177 0.23
178 0.21
179 0.21
180 0.2
181 0.17
182 0.18
183 0.18
184 0.18
185 0.16
186 0.16
187 0.15
188 0.19
189 0.21
190 0.19
191 0.21
192 0.24
193 0.25
194 0.26
195 0.27
196 0.26
197 0.27
198 0.27
199 0.27
200 0.28
201 0.27
202 0.26
203 0.25
204 0.2
205 0.19
206 0.19
207 0.17
208 0.12
209 0.11
210 0.13
211 0.15
212 0.19
213 0.19
214 0.26