Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4ARH0

Protein Details
Accession D4ARH0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-70EIKKGREQALRERRRRRERRKKEEEKRPNGDRRDEBasic
NLS Segment(s)
PositionSequence
30-69QKEKDKEIKKGREQALRERRRRRERRKKEEEKRPNGDRRD
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG abe:ARB_06713  -  
Amino Acid Sequences MTPGTKGESWSESAGKESGHGRDARKCDGQKEKDKEIKKGREQALRERRRRRERRKKEEEKRPNGDRRDEAEEEKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.18
4 0.18
5 0.17
6 0.19
7 0.22
8 0.23
9 0.29
10 0.33
11 0.36
12 0.4
13 0.4
14 0.43
15 0.49
16 0.55
17 0.58
18 0.6
19 0.64
20 0.64
21 0.65
22 0.67
23 0.66
24 0.67
25 0.63
26 0.65
27 0.62
28 0.61
29 0.61
30 0.63
31 0.65
32 0.66
33 0.7
34 0.71
35 0.76
36 0.8
37 0.89
38 0.89
39 0.9
40 0.92
41 0.94
42 0.95
43 0.96
44 0.95
45 0.96
46 0.95
47 0.94
48 0.92
49 0.9
50 0.88
51 0.83
52 0.8
53 0.74
54 0.69
55 0.67
56 0.62
57 0.59