Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AUU7

Protein Details
Accession D4AUU7    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-81EEEPETPPARRRRQRQQTPTARRAAPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 7, nucl 6, plas 3, cyto_nucl 3
Family & Domain DBs
KEGG abe:ARB_08014  -  
Amino Acid Sequences MYLLTLSLAIPLSLAMYFLVCRQLKQTFHGAPKLRPATFRPAKPTKNNQASQQQQEEEPETPPARRRRQRQQTPTARRAAPAESEKDSLPNKGPAKLSGPLSLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.07
6 0.15
7 0.14
8 0.15
9 0.19
10 0.25
11 0.26
12 0.29
13 0.36
14 0.34
15 0.38
16 0.46
17 0.45
18 0.41
19 0.49
20 0.51
21 0.43
22 0.4
23 0.39
24 0.42
25 0.45
26 0.47
27 0.46
28 0.49
29 0.54
30 0.6
31 0.65
32 0.65
33 0.68
34 0.66
35 0.63
36 0.64
37 0.63
38 0.59
39 0.53
40 0.43
41 0.34
42 0.34
43 0.31
44 0.23
45 0.18
46 0.18
47 0.16
48 0.16
49 0.23
50 0.3
51 0.38
52 0.45
53 0.53
54 0.61
55 0.71
56 0.8
57 0.83
58 0.86
59 0.87
60 0.89
61 0.87
62 0.83
63 0.72
64 0.63
65 0.55
66 0.47
67 0.42
68 0.37
69 0.34
70 0.31
71 0.32
72 0.3
73 0.33
74 0.32
75 0.29
76 0.28
77 0.33
78 0.32
79 0.35
80 0.37
81 0.35
82 0.38
83 0.4
84 0.39
85 0.35