Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4ARA6

Protein Details
Accession D4ARA6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-29KRDGEEEKIQWKRRRRRRQVDMLTYEGYBasic
NLS Segment(s)
PositionSequence
13-19KRRRRRR
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
KEGG abe:ARB_06646  -  
Amino Acid Sequences MKRDGEEEKIQWKRRRRRRQVDMLTYEGYGMVLDFVVVKVASSSETGEGGGGGGGGANGGVTSGIMPILLMGQVEEKAVSSFICSQKDGKKLDEDIPLLPWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.86
3 0.87
4 0.89
5 0.9
6 0.94
7 0.94
8 0.94
9 0.88
10 0.81
11 0.7
12 0.59
13 0.48
14 0.37
15 0.26
16 0.15
17 0.09
18 0.05
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.04
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.01
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.08
68 0.14
69 0.18
70 0.21
71 0.22
72 0.27
73 0.33
74 0.4
75 0.41
76 0.38
77 0.4
78 0.41
79 0.45
80 0.47
81 0.42
82 0.37