Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B0T2

Protein Details
Accession D4B0T2    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-84SDQKPVEKEKDKKKKKPSAAPSNEPMHydrophilic
NLS Segment(s)
PositionSequence
13-76GRSRGLERGYRGGDRRRSPFRDRDRERDRDLDRGRDRERRAARDDPSDQKPVEKEKDKKKKKPS
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
KEGG abe:ARB_02058  -  
Amino Acid Sequences RRDDDRDRERDSGRSRGLERGYRGGDRRRSPFRDRDRERDRDLDRGRDRERRAARDDPSDQKPVEKEKDKKKKKPSAAPSNEPMIIVNVNDRLGTKAAIPCLASDPIRKPSWLALYPALT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.51
4 0.54
5 0.51
6 0.5
7 0.48
8 0.47
9 0.46
10 0.5
11 0.51
12 0.54
13 0.54
14 0.58
15 0.6
16 0.63
17 0.65
18 0.7
19 0.72
20 0.75
21 0.75
22 0.77
23 0.77
24 0.77
25 0.74
26 0.72
27 0.64
28 0.63
29 0.59
30 0.59
31 0.55
32 0.56
33 0.56
34 0.55
35 0.55
36 0.55
37 0.57
38 0.53
39 0.54
40 0.53
41 0.5
42 0.49
43 0.51
44 0.47
45 0.45
46 0.43
47 0.37
48 0.33
49 0.32
50 0.31
51 0.34
52 0.36
53 0.4
54 0.48
55 0.59
56 0.67
57 0.75
58 0.8
59 0.83
60 0.84
61 0.86
62 0.86
63 0.87
64 0.85
65 0.81
66 0.74
67 0.68
68 0.59
69 0.49
70 0.38
71 0.28
72 0.2
73 0.14
74 0.13
75 0.1
76 0.1
77 0.1
78 0.1
79 0.11
80 0.11
81 0.12
82 0.13
83 0.14
84 0.15
85 0.17
86 0.17
87 0.16
88 0.18
89 0.21
90 0.19
91 0.22
92 0.25
93 0.31
94 0.32
95 0.31
96 0.3
97 0.33
98 0.4
99 0.38
100 0.37