Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2HAN6

Protein Details
Accession Q2HAN6    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKAAKSRSGKAEKKTRQKKDPNAPKRGLSHydrophilic
NLS Segment(s)
PositionSequence
3-27KAAKSRSGKAEKKTRQKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAAKSRSGKAEKKTRQKKDPNAPKRGLSAYMFFANEQRDNVREENPGVSFGQVGKILGERWKALSDKQRAPYEAKAAADKKRYEDEKQAYNVSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.85
4 0.85
5 0.89
6 0.9
7 0.9
8 0.92
9 0.91
10 0.89
11 0.83
12 0.75
13 0.69
14 0.6
15 0.52
16 0.43
17 0.35
18 0.28
19 0.26
20 0.24
21 0.2
22 0.2
23 0.19
24 0.18
25 0.17
26 0.15
27 0.14
28 0.17
29 0.18
30 0.18
31 0.16
32 0.16
33 0.17
34 0.15
35 0.16
36 0.13
37 0.11
38 0.09
39 0.08
40 0.09
41 0.08
42 0.07
43 0.06
44 0.07
45 0.08
46 0.1
47 0.12
48 0.11
49 0.12
50 0.15
51 0.16
52 0.2
53 0.28
54 0.33
55 0.39
56 0.46
57 0.49
58 0.49
59 0.52
60 0.51
61 0.47
62 0.43
63 0.37
64 0.37
65 0.37
66 0.41
67 0.44
68 0.42
69 0.41
70 0.47
71 0.5
72 0.49
73 0.54
74 0.54
75 0.55
76 0.58