Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AW80

Protein Details
Accession D4AW80    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-61REKVREGRKGKKGRKEREREREEMRRRPRDRQDRQQEEEEBasic
NLS Segment(s)
PositionSequence
19-51RFGREKVREGRKGKKGRKEREREREEMRRRPRD
Subcellular Location(s) nucl 18, cyto 6, mito 1, pero 1, vacu 1
Family & Domain DBs
KEGG abe:ARB_00445  -  
Amino Acid Sequences MGEIGAGGEEGCWFWVVRRFGREKVREGRKGKKGRKEREREREEMRRRPRDRQDRQQEEEEEEELTHVRDKDEEEDGRGRTLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.15
3 0.19
4 0.22
5 0.29
6 0.33
7 0.4
8 0.5
9 0.52
10 0.52
11 0.58
12 0.65
13 0.67
14 0.68
15 0.71
16 0.71
17 0.77
18 0.77
19 0.78
20 0.78
21 0.8
22 0.85
23 0.86
24 0.86
25 0.86
26 0.85
27 0.79
28 0.77
29 0.76
30 0.74
31 0.73
32 0.72
33 0.72
34 0.7
35 0.74
36 0.77
37 0.78
38 0.79
39 0.81
40 0.82
41 0.8
42 0.81
43 0.79
44 0.7
45 0.63
46 0.55
47 0.44
48 0.34
49 0.25
50 0.21
51 0.14
52 0.13
53 0.13
54 0.12
55 0.12
56 0.12
57 0.15
58 0.18
59 0.24
60 0.25
61 0.26
62 0.3
63 0.31