Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4ATM0

Protein Details
Accession D4ATM0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-58VSGVRKEKKTQYRQYMNRVGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.833, cyto 7.5, cyto_pero 5.832, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG abe:ARB_07584  -  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MEVDIPDDPDDLDQVMMKAMGFSSFKSTQNTKVPGNNVSGVRKEKKTQYRQYMNRVGGFNKPLSPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.05
7 0.07
8 0.07
9 0.08
10 0.14
11 0.16
12 0.19
13 0.23
14 0.24
15 0.28
16 0.34
17 0.38
18 0.33
19 0.34
20 0.34
21 0.32
22 0.33
23 0.3
24 0.26
25 0.24
26 0.26
27 0.28
28 0.31
29 0.32
30 0.34
31 0.4
32 0.48
33 0.56
34 0.62
35 0.67
36 0.73
37 0.77
38 0.83
39 0.83
40 0.77
41 0.72
42 0.64
43 0.55
44 0.51
45 0.48
46 0.41
47 0.35