Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B4I9

Protein Details
Accession D4B4I9   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-84EDEPGGSRRKGKKKKKTTKKKQYIHLRIRYREKYBasic
NLS Segment(s)
PositionSequence
56-83GSRRKGKKKKKTTKKKQYIHLRIRYREK
89-94IRKKAQ
Subcellular Location(s) nucl 15, cyto_nucl 11.5, mito 6, cyto 6
Family & Domain DBs
KEGG abe:ARB_03379  -  
Amino Acid Sequences MAPAAAMHPGLFVFDQAMGILDSSVQFRVAGRSSASSQSGGASVTSPTQDEDEPGGSRRKGKKKKKTTKKKQYIHLRIRYREKYQSSLIRKKAQKKEEETTKTPTEPPAIHGCDVMRAAVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.06
6 0.06
7 0.06
8 0.05
9 0.06
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.11
16 0.12
17 0.13
18 0.13
19 0.15
20 0.17
21 0.2
22 0.21
23 0.18
24 0.16
25 0.15
26 0.15
27 0.12
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.11
41 0.13
42 0.15
43 0.14
44 0.21
45 0.29
46 0.38
47 0.47
48 0.57
49 0.66
50 0.75
51 0.85
52 0.9
53 0.93
54 0.94
55 0.95
56 0.95
57 0.92
58 0.9
59 0.91
60 0.9
61 0.89
62 0.87
63 0.84
64 0.8
65 0.82
66 0.78
67 0.72
68 0.69
69 0.63
70 0.58
71 0.56
72 0.58
73 0.58
74 0.62
75 0.63
76 0.63
77 0.67
78 0.73
79 0.76
80 0.75
81 0.74
82 0.73
83 0.76
84 0.77
85 0.78
86 0.72
87 0.69
88 0.65
89 0.59
90 0.53
91 0.46
92 0.41
93 0.34
94 0.35
95 0.36
96 0.36
97 0.34
98 0.34
99 0.31
100 0.29
101 0.29