Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4ATQ4

Protein Details
Accession D4ATQ4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
156-205SQNGTRKRGLPRRSQRIAKKQRQKKVGAKRVEKAPSTATNRIKKRQQRGKHydrophilic
NLS Segment(s)
PositionSequence
149-205KKLRKSPSQNGTRKRGLPRRSQRIAKKQRQKKVGAKRVEKAPSTATNRIKKRQQRGK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG abe:ARB_07620  -  
Amino Acid Sequences MTIADIMLAQRPLTPPYTAPRDPEPTQYNLPQKNDTLLTELSGRCNTSLQNTLSKPTFQRLAEEVVSKSISSGSTKDTRDLEPRIHFAVSQTAQKLSQQATTTVNGIYFELTKLLPTRLQPFLLNFIGKEASEEDRYTFIINVLPWILKKLRKSPSQNGTRKRGLPRRSQRIAKKQRQKKVGAKRVEKAPSTATNRIKKRQQRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.26
4 0.34
5 0.34
6 0.37
7 0.41
8 0.46
9 0.46
10 0.52
11 0.49
12 0.45
13 0.49
14 0.52
15 0.54
16 0.54
17 0.56
18 0.5
19 0.47
20 0.46
21 0.42
22 0.36
23 0.31
24 0.24
25 0.22
26 0.23
27 0.22
28 0.21
29 0.21
30 0.2
31 0.17
32 0.18
33 0.17
34 0.17
35 0.23
36 0.22
37 0.27
38 0.28
39 0.31
40 0.32
41 0.34
42 0.31
43 0.29
44 0.32
45 0.25
46 0.28
47 0.25
48 0.28
49 0.27
50 0.28
51 0.24
52 0.21
53 0.21
54 0.17
55 0.15
56 0.11
57 0.11
58 0.1
59 0.11
60 0.13
61 0.19
62 0.2
63 0.22
64 0.24
65 0.25
66 0.29
67 0.3
68 0.31
69 0.28
70 0.29
71 0.28
72 0.26
73 0.23
74 0.19
75 0.22
76 0.19
77 0.19
78 0.17
79 0.16
80 0.16
81 0.17
82 0.19
83 0.14
84 0.16
85 0.14
86 0.15
87 0.16
88 0.16
89 0.16
90 0.14
91 0.13
92 0.1
93 0.09
94 0.08
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.09
103 0.11
104 0.15
105 0.16
106 0.18
107 0.18
108 0.18
109 0.21
110 0.21
111 0.2
112 0.15
113 0.15
114 0.14
115 0.13
116 0.13
117 0.1
118 0.12
119 0.13
120 0.14
121 0.13
122 0.14
123 0.14
124 0.14
125 0.13
126 0.1
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.09
133 0.13
134 0.16
135 0.18
136 0.23
137 0.31
138 0.38
139 0.47
140 0.55
141 0.61
142 0.67
143 0.74
144 0.79
145 0.78
146 0.78
147 0.76
148 0.74
149 0.75
150 0.74
151 0.71
152 0.73
153 0.76
154 0.78
155 0.8
156 0.83
157 0.83
158 0.85
159 0.89
160 0.88
161 0.88
162 0.88
163 0.88
164 0.88
165 0.87
166 0.86
167 0.86
168 0.85
169 0.85
170 0.83
171 0.81
172 0.81
173 0.79
174 0.7
175 0.62
176 0.59
177 0.58
178 0.57
179 0.59
180 0.59
181 0.61
182 0.67
183 0.73
184 0.77
185 0.78