Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AL29

Protein Details
Accession D4AL29    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
307-326VFRFRHPRGWPQSREKQRWVHydrophilic
345-371CFPYLVRIEPKKNSKKKPTNSSEMFRIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 11.5, nucl 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009003  Peptidase_S1_PA  
IPR043504  Peptidase_S1_PA_chymotrypsin  
KEGG abe:ARB_05025  -  
Pfam View protein in Pfam  
PF13365  Trypsin_2  
Amino Acid Sequences MSTTPSSLHLDPDLFDPSWVALPNDKGATGGLSFASTQIRNSWIVRLDFRQNSESGLTHVLTLAHTAPKGEKSHGTGFYVNIPGTKAHVILTAAHNLVDKQNKPSQDLQFYDPLQGAIIKPGDPDIFVSPSYSSRPRTETDFGAIRVPTSTSVSRGFGFALKLAEESLRDKSLQICGFPSDCTRPEPSTSSGDCKRWNRSRIEYQIATAKGLSGAPVFMPFKGHDTVVGIHETVLEQIFRWLGVSHEEKALRVFPSKDAPLEGLYLRFPPFEQHGWVRLGEKGLETTFDIFPAYAPTSNLTGKPTYVFRFRHPRGWPQSREKQRWVLWDYVRQVVTLTDKLEDCCFPYLVRIEPKKNSKKKPTNSSEMFRIVLERKDPGNPADIGQLVEFRMANFLLKEEDIEMEEMDTPEVGFMKHYINKPAKVCFKAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.17
5 0.18
6 0.19
7 0.17
8 0.17
9 0.19
10 0.23
11 0.23
12 0.22
13 0.19
14 0.18
15 0.19
16 0.15
17 0.14
18 0.1
19 0.1
20 0.1
21 0.11
22 0.15
23 0.14
24 0.15
25 0.16
26 0.19
27 0.21
28 0.23
29 0.26
30 0.27
31 0.3
32 0.33
33 0.36
34 0.42
35 0.43
36 0.46
37 0.44
38 0.39
39 0.38
40 0.36
41 0.32
42 0.25
43 0.24
44 0.2
45 0.17
46 0.17
47 0.15
48 0.13
49 0.14
50 0.14
51 0.13
52 0.13
53 0.14
54 0.16
55 0.21
56 0.23
57 0.25
58 0.26
59 0.3
60 0.37
61 0.38
62 0.4
63 0.35
64 0.34
65 0.35
66 0.34
67 0.28
68 0.22
69 0.2
70 0.17
71 0.18
72 0.18
73 0.14
74 0.12
75 0.14
76 0.14
77 0.16
78 0.18
79 0.19
80 0.18
81 0.18
82 0.17
83 0.16
84 0.21
85 0.25
86 0.24
87 0.26
88 0.31
89 0.32
90 0.36
91 0.43
92 0.44
93 0.45
94 0.46
95 0.43
96 0.44
97 0.43
98 0.4
99 0.33
100 0.27
101 0.2
102 0.18
103 0.14
104 0.12
105 0.12
106 0.11
107 0.11
108 0.12
109 0.12
110 0.11
111 0.13
112 0.12
113 0.13
114 0.13
115 0.14
116 0.13
117 0.14
118 0.18
119 0.21
120 0.22
121 0.23
122 0.27
123 0.27
124 0.33
125 0.34
126 0.32
127 0.32
128 0.31
129 0.29
130 0.29
131 0.27
132 0.21
133 0.18
134 0.17
135 0.14
136 0.14
137 0.14
138 0.13
139 0.15
140 0.17
141 0.16
142 0.16
143 0.16
144 0.14
145 0.14
146 0.12
147 0.11
148 0.1
149 0.09
150 0.09
151 0.09
152 0.09
153 0.1
154 0.11
155 0.12
156 0.12
157 0.12
158 0.14
159 0.19
160 0.19
161 0.18
162 0.16
163 0.17
164 0.17
165 0.18
166 0.19
167 0.16
168 0.16
169 0.18
170 0.21
171 0.21
172 0.22
173 0.25
174 0.25
175 0.27
176 0.27
177 0.31
178 0.31
179 0.33
180 0.38
181 0.39
182 0.45
183 0.48
184 0.52
185 0.52
186 0.54
187 0.6
188 0.59
189 0.61
190 0.52
191 0.46
192 0.45
193 0.4
194 0.33
195 0.24
196 0.18
197 0.12
198 0.12
199 0.11
200 0.05
201 0.05
202 0.04
203 0.07
204 0.07
205 0.07
206 0.08
207 0.08
208 0.11
209 0.12
210 0.12
211 0.1
212 0.11
213 0.12
214 0.12
215 0.12
216 0.09
217 0.08
218 0.09
219 0.08
220 0.07
221 0.06
222 0.05
223 0.04
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.09
231 0.12
232 0.12
233 0.16
234 0.16
235 0.16
236 0.17
237 0.19
238 0.16
239 0.17
240 0.17
241 0.15
242 0.2
243 0.21
244 0.2
245 0.18
246 0.18
247 0.16
248 0.17
249 0.15
250 0.11
251 0.11
252 0.12
253 0.12
254 0.11
255 0.1
256 0.11
257 0.14
258 0.14
259 0.17
260 0.18
261 0.21
262 0.23
263 0.23
264 0.22
265 0.2
266 0.19
267 0.16
268 0.14
269 0.12
270 0.11
271 0.11
272 0.11
273 0.12
274 0.11
275 0.11
276 0.11
277 0.09
278 0.09
279 0.11
280 0.12
281 0.1
282 0.1
283 0.11
284 0.14
285 0.16
286 0.17
287 0.16
288 0.16
289 0.15
290 0.17
291 0.2
292 0.2
293 0.27
294 0.28
295 0.33
296 0.43
297 0.45
298 0.52
299 0.52
300 0.59
301 0.61
302 0.69
303 0.7
304 0.69
305 0.76
306 0.78
307 0.82
308 0.77
309 0.75
310 0.7
311 0.7
312 0.64
313 0.62
314 0.56
315 0.55
316 0.52
317 0.49
318 0.46
319 0.37
320 0.33
321 0.27
322 0.27
323 0.22
324 0.2
325 0.17
326 0.17
327 0.19
328 0.21
329 0.19
330 0.18
331 0.18
332 0.17
333 0.15
334 0.18
335 0.19
336 0.23
337 0.32
338 0.36
339 0.41
340 0.49
341 0.59
342 0.67
343 0.74
344 0.79
345 0.81
346 0.84
347 0.88
348 0.91
349 0.89
350 0.88
351 0.86
352 0.81
353 0.76
354 0.69
355 0.6
356 0.49
357 0.46
358 0.38
359 0.35
360 0.31
361 0.28
362 0.27
363 0.3
364 0.32
365 0.29
366 0.3
367 0.27
368 0.26
369 0.26
370 0.25
371 0.22
372 0.19
373 0.19
374 0.15
375 0.16
376 0.15
377 0.11
378 0.13
379 0.12
380 0.13
381 0.12
382 0.13
383 0.13
384 0.13
385 0.14
386 0.13
387 0.14
388 0.14
389 0.14
390 0.13
391 0.12
392 0.13
393 0.13
394 0.12
395 0.11
396 0.09
397 0.09
398 0.1
399 0.08
400 0.08
401 0.09
402 0.16
403 0.22
404 0.26
405 0.35
406 0.42
407 0.49
408 0.52
409 0.6
410 0.62
411 0.59