Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AIM5

Protein Details
Accession D4AIM5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-117KPFPPGEKKRAVKKGSRRPTQSARAGBasic
NLS Segment(s)
PositionSequence
96-110PGEKKRAVKKGSRRP
Subcellular Location(s) nucl 14, extr 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
KEGG abe:ARB_04120  -  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MGNGSAAVLEPTYTGYVASTHDALILFEACLTGVLHHVPRRPHDRERAQLVRSGSVFIYEENASGIKRWTDGVTWSPSRILGNFLVYRELDKPFPPGEKKRAVKKGSRRPTQSARAGEPYPRLQDNGTPVNGSVGSVASVTGSAYSPGAPSPVAGAGPGGAGAGGPVSGNGTGFAPERGQQSELERALVGSLVDSYGFKDSGLVKKTMSVTVSGVTHHLVSYYSVDDVMRGVLSPPSMVESLRYIRPRQELTTKQSFRAPIEDPDQPSLDDGDPSQSLYAYRPNPATAAAMVPQYGMPQSTGYYAMPQPYSSHHHQQQQQQQQHQHPHHQQQQHPSQQPQQHHPQQSAHHQHPHHQPPPPHQQHPSQQPPPPSVPGYGVAPPQQNPYLQQSPAAATSDLPPKSEEYASYRGPSAAAAYQNAAAAAAAAAYPPSSAAASAAPHIYRTPSIPTRPGPSDMPPTSLDPAGSPSAATTYSRASFSLPGSIDSKPQTSPPQQQAPNPQQQQSQQQQQQQQQQPLDRSPYASSSARRESGYYDQAQAQAQAQAQAAHQRRASIQAPPQQQQPPQPPQQPSQPYYSGTAATGQTSYQGPPPMSTWGATHGQAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.11
5 0.14
6 0.13
7 0.12
8 0.14
9 0.14
10 0.14
11 0.14
12 0.13
13 0.1
14 0.09
15 0.09
16 0.07
17 0.08
18 0.08
19 0.07
20 0.08
21 0.11
22 0.17
23 0.22
24 0.27
25 0.31
26 0.39
27 0.48
28 0.53
29 0.59
30 0.64
31 0.7
32 0.73
33 0.78
34 0.78
35 0.7
36 0.68
37 0.61
38 0.55
39 0.46
40 0.4
41 0.3
42 0.24
43 0.23
44 0.18
45 0.19
46 0.15
47 0.14
48 0.13
49 0.14
50 0.12
51 0.13
52 0.15
53 0.12
54 0.13
55 0.14
56 0.15
57 0.16
58 0.19
59 0.23
60 0.29
61 0.3
62 0.3
63 0.29
64 0.29
65 0.29
66 0.26
67 0.25
68 0.19
69 0.23
70 0.24
71 0.24
72 0.25
73 0.23
74 0.26
75 0.24
76 0.25
77 0.21
78 0.2
79 0.24
80 0.24
81 0.31
82 0.37
83 0.43
84 0.48
85 0.56
86 0.62
87 0.68
88 0.75
89 0.75
90 0.76
91 0.79
92 0.81
93 0.82
94 0.84
95 0.81
96 0.8
97 0.82
98 0.82
99 0.8
100 0.74
101 0.68
102 0.64
103 0.59
104 0.55
105 0.5
106 0.45
107 0.42
108 0.37
109 0.34
110 0.29
111 0.31
112 0.33
113 0.33
114 0.29
115 0.25
116 0.24
117 0.25
118 0.23
119 0.2
120 0.14
121 0.08
122 0.08
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.07
134 0.07
135 0.08
136 0.07
137 0.06
138 0.07
139 0.08
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.02
152 0.02
153 0.02
154 0.03
155 0.04
156 0.04
157 0.05
158 0.05
159 0.06
160 0.07
161 0.08
162 0.08
163 0.11
164 0.13
165 0.15
166 0.15
167 0.16
168 0.18
169 0.24
170 0.24
171 0.22
172 0.19
173 0.18
174 0.17
175 0.15
176 0.12
177 0.05
178 0.05
179 0.04
180 0.04
181 0.05
182 0.06
183 0.07
184 0.07
185 0.07
186 0.09
187 0.12
188 0.18
189 0.21
190 0.21
191 0.19
192 0.23
193 0.25
194 0.24
195 0.22
196 0.17
197 0.15
198 0.16
199 0.16
200 0.13
201 0.12
202 0.11
203 0.1
204 0.09
205 0.08
206 0.07
207 0.07
208 0.08
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.07
215 0.07
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.05
223 0.07
224 0.08
225 0.07
226 0.08
227 0.1
228 0.13
229 0.18
230 0.2
231 0.2
232 0.23
233 0.28
234 0.3
235 0.3
236 0.36
237 0.37
238 0.42
239 0.51
240 0.49
241 0.46
242 0.47
243 0.45
244 0.37
245 0.36
246 0.3
247 0.23
248 0.25
249 0.28
250 0.26
251 0.26
252 0.25
253 0.21
254 0.19
255 0.18
256 0.14
257 0.11
258 0.09
259 0.09
260 0.09
261 0.09
262 0.09
263 0.07
264 0.07
265 0.08
266 0.14
267 0.13
268 0.15
269 0.15
270 0.16
271 0.16
272 0.16
273 0.16
274 0.1
275 0.1
276 0.08
277 0.08
278 0.07
279 0.07
280 0.07
281 0.06
282 0.06
283 0.05
284 0.05
285 0.05
286 0.05
287 0.06
288 0.07
289 0.07
290 0.09
291 0.1
292 0.11
293 0.11
294 0.11
295 0.11
296 0.12
297 0.18
298 0.2
299 0.27
300 0.3
301 0.37
302 0.42
303 0.49
304 0.55
305 0.59
306 0.6
307 0.59
308 0.6
309 0.6
310 0.63
311 0.58
312 0.58
313 0.55
314 0.58
315 0.6
316 0.6
317 0.58
318 0.58
319 0.63
320 0.63
321 0.6
322 0.55
323 0.54
324 0.53
325 0.53
326 0.5
327 0.51
328 0.51
329 0.5
330 0.49
331 0.46
332 0.44
333 0.5
334 0.52
335 0.46
336 0.45
337 0.43
338 0.48
339 0.54
340 0.59
341 0.54
342 0.52
343 0.52
344 0.52
345 0.63
346 0.62
347 0.57
348 0.52
349 0.54
350 0.56
351 0.62
352 0.64
353 0.58
354 0.56
355 0.55
356 0.55
357 0.51
358 0.46
359 0.38
360 0.3
361 0.25
362 0.23
363 0.22
364 0.19
365 0.18
366 0.18
367 0.18
368 0.18
369 0.2
370 0.2
371 0.18
372 0.19
373 0.25
374 0.25
375 0.24
376 0.24
377 0.22
378 0.22
379 0.22
380 0.21
381 0.14
382 0.11
383 0.14
384 0.2
385 0.19
386 0.19
387 0.18
388 0.18
389 0.21
390 0.21
391 0.2
392 0.18
393 0.23
394 0.24
395 0.24
396 0.23
397 0.21
398 0.2
399 0.19
400 0.15
401 0.13
402 0.12
403 0.12
404 0.12
405 0.12
406 0.12
407 0.12
408 0.1
409 0.06
410 0.05
411 0.04
412 0.04
413 0.03
414 0.03
415 0.03
416 0.03
417 0.03
418 0.03
419 0.04
420 0.04
421 0.04
422 0.05
423 0.06
424 0.07
425 0.08
426 0.1
427 0.1
428 0.1
429 0.11
430 0.12
431 0.12
432 0.13
433 0.19
434 0.23
435 0.27
436 0.31
437 0.34
438 0.38
439 0.4
440 0.42
441 0.37
442 0.36
443 0.42
444 0.37
445 0.38
446 0.33
447 0.33
448 0.32
449 0.3
450 0.26
451 0.17
452 0.19
453 0.17
454 0.15
455 0.12
456 0.1
457 0.11
458 0.11
459 0.12
460 0.1
461 0.12
462 0.14
463 0.15
464 0.15
465 0.16
466 0.18
467 0.18
468 0.23
469 0.19
470 0.2
471 0.21
472 0.22
473 0.24
474 0.24
475 0.25
476 0.2
477 0.23
478 0.29
479 0.34
480 0.42
481 0.46
482 0.53
483 0.55
484 0.59
485 0.66
486 0.67
487 0.7
488 0.66
489 0.61
490 0.56
491 0.57
492 0.62
493 0.6
494 0.61
495 0.57
496 0.61
497 0.65
498 0.68
499 0.74
500 0.71
501 0.7
502 0.66
503 0.65
504 0.63
505 0.6
506 0.58
507 0.49
508 0.44
509 0.39
510 0.36
511 0.35
512 0.34
513 0.34
514 0.35
515 0.4
516 0.4
517 0.39
518 0.37
519 0.37
520 0.4
521 0.43
522 0.38
523 0.35
524 0.34
525 0.36
526 0.35
527 0.31
528 0.25
529 0.22
530 0.21
531 0.2
532 0.19
533 0.17
534 0.18
535 0.26
536 0.29
537 0.31
538 0.31
539 0.3
540 0.31
541 0.36
542 0.37
543 0.35
544 0.39
545 0.42
546 0.49
547 0.5
548 0.56
549 0.55
550 0.58
551 0.59
552 0.61
553 0.62
554 0.64
555 0.69
556 0.67
557 0.66
558 0.71
559 0.71
560 0.64
561 0.62
562 0.56
563 0.51
564 0.5
565 0.47
566 0.38
567 0.29
568 0.3
569 0.24
570 0.22
571 0.2
572 0.16
573 0.16
574 0.17
575 0.17
576 0.18
577 0.22
578 0.22
579 0.23
580 0.25
581 0.28
582 0.28
583 0.27
584 0.24
585 0.24
586 0.27