Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B2W4

Protein Details
Accession D4B2W4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
289-308YTADRKPKFNADCKVNKKKDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, E.R. 2, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000490  Glyco_hydro_17  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005576  C:extracellular region  
GO:0004338  F:glucan exo-1,3-beta-glucosidase activity  
GO:0005975  P:carbohydrate metabolic process  
KEGG abe:ARB_02797  -  
Pfam View protein in Pfam  
PF00332  Glyco_hydro_17  
Amino Acid Sequences MRFSTALSLALAVSPAAVFAAGNLGFSLGVKRPDGQCKDQADFEKDFDTLKAHGTTVRTYAAADCGSASLILPAAKSKGFKVVLGIWPDVEESYKADVDALKKAVPGNEDVVAAITVGSETLYRGNFTGPELLKKIKEVQKVFPKITIGTADSWNKYADGTADALIEGGVKYLLVNAFAFWQGKAIEQAPKTLFDDLVGAAKRIADKAPQGSSPYVAIGETGWPTDGGTDYGAAKAGTKNAEKFYKEGVCAMLAWGVDAFYFEAFDEPWKPKSIGDNGNAADETHWGMYTADRKPKFNADCKVNKKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.03
7 0.08
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.13
15 0.11
16 0.14
17 0.15
18 0.2
19 0.25
20 0.35
21 0.41
22 0.44
23 0.48
24 0.51
25 0.53
26 0.55
27 0.55
28 0.51
29 0.46
30 0.42
31 0.36
32 0.31
33 0.29
34 0.23
35 0.2
36 0.15
37 0.17
38 0.16
39 0.15
40 0.17
41 0.19
42 0.2
43 0.2
44 0.2
45 0.17
46 0.16
47 0.17
48 0.17
49 0.15
50 0.13
51 0.11
52 0.1
53 0.1
54 0.09
55 0.08
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.09
62 0.1
63 0.11
64 0.12
65 0.19
66 0.19
67 0.19
68 0.21
69 0.25
70 0.28
71 0.3
72 0.3
73 0.22
74 0.22
75 0.22
76 0.19
77 0.14
78 0.1
79 0.08
80 0.1
81 0.1
82 0.1
83 0.1
84 0.12
85 0.13
86 0.16
87 0.16
88 0.14
89 0.15
90 0.16
91 0.17
92 0.16
93 0.16
94 0.14
95 0.14
96 0.14
97 0.13
98 0.12
99 0.1
100 0.09
101 0.07
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.05
109 0.06
110 0.06
111 0.07
112 0.07
113 0.08
114 0.09
115 0.14
116 0.13
117 0.15
118 0.17
119 0.19
120 0.18
121 0.19
122 0.26
123 0.26
124 0.33
125 0.33
126 0.39
127 0.47
128 0.51
129 0.5
130 0.44
131 0.4
132 0.33
133 0.31
134 0.25
135 0.16
136 0.13
137 0.16
138 0.17
139 0.16
140 0.17
141 0.16
142 0.14
143 0.13
144 0.11
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.04
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.06
165 0.07
166 0.08
167 0.07
168 0.08
169 0.08
170 0.08
171 0.1
172 0.11
173 0.15
174 0.14
175 0.19
176 0.18
177 0.2
178 0.2
179 0.2
180 0.18
181 0.13
182 0.14
183 0.1
184 0.14
185 0.12
186 0.11
187 0.1
188 0.11
189 0.11
190 0.12
191 0.12
192 0.1
193 0.13
194 0.17
195 0.19
196 0.2
197 0.22
198 0.22
199 0.22
200 0.2
201 0.17
202 0.13
203 0.11
204 0.1
205 0.07
206 0.08
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.07
217 0.07
218 0.08
219 0.09
220 0.08
221 0.09
222 0.09
223 0.12
224 0.15
225 0.18
226 0.21
227 0.26
228 0.32
229 0.32
230 0.33
231 0.37
232 0.37
233 0.34
234 0.33
235 0.28
236 0.23
237 0.22
238 0.2
239 0.16
240 0.11
241 0.1
242 0.09
243 0.07
244 0.06
245 0.07
246 0.07
247 0.05
248 0.06
249 0.05
250 0.06
251 0.07
252 0.09
253 0.13
254 0.16
255 0.19
256 0.22
257 0.23
258 0.24
259 0.32
260 0.38
261 0.42
262 0.41
263 0.46
264 0.43
265 0.45
266 0.43
267 0.35
268 0.27
269 0.2
270 0.2
271 0.13
272 0.12
273 0.1
274 0.1
275 0.15
276 0.21
277 0.27
278 0.35
279 0.37
280 0.4
281 0.44
282 0.54
283 0.58
284 0.6
285 0.62
286 0.62
287 0.7
288 0.77