Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AU09

Protein Details
Accession D4AU09    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRQPRKLKWTKTHRALHGKEMBasic
NLS Segment(s)
PositionSequence
61-90IRQRRERVYTKRRLAGKIARDRKRAEDRRV
Subcellular Location(s) mito 15.5, cyto_mito 9.833, nucl 8.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000988  Ribosomal_L24e-rel  
KEGG abe:ARB_07822  -  
Amino Acid Sequences MKRQPRKLKWTKTHRALHGKEMIVDSSLVLSQFAKKRNAPVKYDRNLVESTIKAMKRVEEIRQRRERVYTKRRLAGKIARDRKRAEDRRVVAEGEHLIRKELKEMAEGAKKPEDLLNRKVGLPVGEEKLRGKQKSKLLVDGGVEEEMDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.81
4 0.79
5 0.75
6 0.65
7 0.57
8 0.5
9 0.41
10 0.31
11 0.27
12 0.19
13 0.12
14 0.11
15 0.09
16 0.08
17 0.08
18 0.13
19 0.18
20 0.23
21 0.27
22 0.28
23 0.38
24 0.46
25 0.51
26 0.51
27 0.56
28 0.61
29 0.6
30 0.64
31 0.56
32 0.51
33 0.46
34 0.42
35 0.35
36 0.26
37 0.25
38 0.25
39 0.24
40 0.21
41 0.21
42 0.21
43 0.22
44 0.25
45 0.29
46 0.33
47 0.4
48 0.48
49 0.56
50 0.57
51 0.54
52 0.58
53 0.58
54 0.59
55 0.62
56 0.62
57 0.6
58 0.63
59 0.65
60 0.6
61 0.58
62 0.54
63 0.53
64 0.53
65 0.58
66 0.58
67 0.59
68 0.58
69 0.61
70 0.65
71 0.64
72 0.61
73 0.6
74 0.56
75 0.57
76 0.57
77 0.49
78 0.38
79 0.32
80 0.27
81 0.21
82 0.2
83 0.14
84 0.14
85 0.15
86 0.15
87 0.16
88 0.16
89 0.14
90 0.14
91 0.16
92 0.2
93 0.25
94 0.26
95 0.27
96 0.27
97 0.27
98 0.26
99 0.28
100 0.31
101 0.3
102 0.34
103 0.38
104 0.37
105 0.37
106 0.38
107 0.35
108 0.28
109 0.25
110 0.25
111 0.23
112 0.23
113 0.24
114 0.24
115 0.32
116 0.39
117 0.4
118 0.4
119 0.43
120 0.49
121 0.58
122 0.6
123 0.58
124 0.53
125 0.52
126 0.49
127 0.44
128 0.38
129 0.28
130 0.23