Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AZU1

Protein Details
Accession D4AZU1   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32DELVSSRRQARRQRRPAAKAAKAHydrophilic
NLS Segment(s)
PositionSequence
16-47RRQARRQRRPAAKAAKAAPVGGVRKSTRQPKP
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
KEGG abe:ARB_01711  -  
Amino Acid Sequences MSEKLDKALDELVSSRRQARRQRRPAAKAAKAAPVGGVRKSTRQPKPTSKATPTAPAAGSGDGKIIVSGLVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.29
4 0.37
5 0.46
6 0.55
7 0.63
8 0.7
9 0.8
10 0.83
11 0.83
12 0.85
13 0.84
14 0.78
15 0.72
16 0.64
17 0.59
18 0.49
19 0.43
20 0.35
21 0.28
22 0.24
23 0.19
24 0.2
25 0.16
26 0.19
27 0.25
28 0.33
29 0.37
30 0.42
31 0.49
32 0.56
33 0.62
34 0.68
35 0.7
36 0.65
37 0.64
38 0.6
39 0.59
40 0.52
41 0.48
42 0.39
43 0.33
44 0.3
45 0.25
46 0.23
47 0.16
48 0.14
49 0.11
50 0.11
51 0.09
52 0.08
53 0.06