Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AN48

Protein Details
Accession D4AN48   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
144-167ASLGFLRLYRRRRRRREIDSYLAAHydrophilic
NLS Segment(s)
PositionSequence
153-158RRRRRR
Subcellular Location(s) nucl 11, plas 7, mito 4, cyto 2, E.R. 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG abe:ARB_05652  -  
Amino Acid Sequences MRVYSDYCRTRWRLPETSYSNNGEATLDYGGWEAEYAGRCLASSSNSHCLWLVAVDERYSELLSMNIEIPEQILSRTRRFRFDIKGCDGDTHHDHGQAAISSDEFRVSTSTRIAVRDAEDDQTLTVGSKTGIGIGIGLAVIALASLGFLRLYRRRRRRREIDSYLAASRPAQTEEAAAAAAAATTSTMAPPETIAEMPTDNETVTQSVFEIEGQGQKLGELQGSLAASEMPASSAHQQPAAPVELPGSIPRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.67
4 0.69
5 0.67
6 0.63
7 0.55
8 0.47
9 0.43
10 0.33
11 0.25
12 0.2
13 0.15
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.07
20 0.06
21 0.08
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.12
29 0.11
30 0.13
31 0.18
32 0.24
33 0.24
34 0.25
35 0.24
36 0.23
37 0.21
38 0.18
39 0.15
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.13
46 0.12
47 0.11
48 0.07
49 0.07
50 0.08
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.13
61 0.16
62 0.23
63 0.31
64 0.33
65 0.37
66 0.41
67 0.46
68 0.5
69 0.54
70 0.56
71 0.53
72 0.55
73 0.5
74 0.48
75 0.43
76 0.38
77 0.33
78 0.29
79 0.24
80 0.22
81 0.21
82 0.19
83 0.2
84 0.15
85 0.13
86 0.08
87 0.08
88 0.07
89 0.07
90 0.08
91 0.06
92 0.06
93 0.07
94 0.08
95 0.09
96 0.09
97 0.12
98 0.13
99 0.14
100 0.14
101 0.14
102 0.14
103 0.15
104 0.15
105 0.14
106 0.12
107 0.12
108 0.11
109 0.09
110 0.08
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.03
124 0.03
125 0.02
126 0.02
127 0.02
128 0.02
129 0.01
130 0.01
131 0.01
132 0.02
133 0.02
134 0.02
135 0.03
136 0.07
137 0.14
138 0.22
139 0.33
140 0.44
141 0.55
142 0.65
143 0.75
144 0.82
145 0.85
146 0.88
147 0.86
148 0.82
149 0.76
150 0.69
151 0.6
152 0.5
153 0.41
154 0.3
155 0.24
156 0.17
157 0.14
158 0.12
159 0.11
160 0.11
161 0.11
162 0.11
163 0.09
164 0.07
165 0.05
166 0.04
167 0.04
168 0.03
169 0.03
170 0.02
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.05
177 0.05
178 0.07
179 0.08
180 0.08
181 0.08
182 0.09
183 0.09
184 0.1
185 0.12
186 0.11
187 0.09
188 0.1
189 0.1
190 0.1
191 0.1
192 0.09
193 0.07
194 0.08
195 0.08
196 0.07
197 0.08
198 0.09
199 0.12
200 0.13
201 0.13
202 0.12
203 0.12
204 0.14
205 0.13
206 0.12
207 0.08
208 0.08
209 0.1
210 0.1
211 0.1
212 0.09
213 0.08
214 0.07
215 0.08
216 0.08
217 0.05
218 0.06
219 0.09
220 0.13
221 0.18
222 0.19
223 0.21
224 0.21
225 0.22
226 0.25
227 0.26
228 0.22
229 0.17
230 0.17
231 0.16
232 0.18
233 0.19