Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4ARB7

Protein Details
Accession D4ARB7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MVAKLYKGSRRREKKRDMALQEEEHydrophilic
NLS Segment(s)
PositionSequence
9-15SRRREKK
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG abe:ARB_06657  -  
Amino Acid Sequences MVAKLYKGSRRREKKRDMALQEEEEKTTVKNRPLNCAVEVKMKKETRRTRQAKGYQIHQCTYHISPRWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.89
4 0.84
5 0.81
6 0.76
7 0.7
8 0.64
9 0.55
10 0.45
11 0.36
12 0.3
13 0.22
14 0.22
15 0.22
16 0.22
17 0.26
18 0.26
19 0.33
20 0.37
21 0.38
22 0.35
23 0.34
24 0.3
25 0.34
26 0.35
27 0.3
28 0.35
29 0.36
30 0.39
31 0.46
32 0.55
33 0.55
34 0.65
35 0.69
36 0.68
37 0.75
38 0.79
39 0.78
40 0.73
41 0.72
42 0.7
43 0.68
44 0.63
45 0.54
46 0.47
47 0.43
48 0.42
49 0.42