Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AIX3

Protein Details
Accession D4AIX3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
367-386ANPLSISRRRSRRHADEDSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008402  APC_su15/mnd2  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
KEGG abe:ARB_04221  -  
Pfam View protein in Pfam  
PF05841  Apc15p  
Amino Acid Sequences MFNPLPPIEPRDSHTLWYSSSYTGRSAANSSQNTTSGAQHPQPGRRNGRSQGTNTPLFSASFDPLSTLLAEERALTLRKQNIASFGFSWIRPAGFPKTMMGLREEEMECEEGAGGGLGEGDIEEEEFMEGVEGGEGGLGLDGAGEGVEGDAGMERDLDGDIPDGDGEGFGLVEEGEEGYEDEEEEFLDEEEEGMMERDLDDDVPEAPDADEEDEDEDGDEDDEEDEEDEEDRYGDTSEVRTPNNNTRTPGESNMMMERDLDGSVPDAPQEAPSQQQEWEHTDSDEDVYDEDDDEDGEEEEEEEGEGEDEGTDEGHSRLSWASLPPGYIPHLTPSGPRRETEAERLFIERWGGNDDSIDIGSSDMLPANPLSISRRRSRRHADEDSDLEEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.32
4 0.34
5 0.33
6 0.27
7 0.29
8 0.28
9 0.25
10 0.25
11 0.25
12 0.23
13 0.25
14 0.28
15 0.33
16 0.34
17 0.36
18 0.36
19 0.35
20 0.36
21 0.34
22 0.32
23 0.28
24 0.31
25 0.3
26 0.35
27 0.4
28 0.46
29 0.52
30 0.58
31 0.63
32 0.64
33 0.7
34 0.69
35 0.73
36 0.71
37 0.67
38 0.67
39 0.65
40 0.62
41 0.54
42 0.5
43 0.41
44 0.35
45 0.32
46 0.25
47 0.21
48 0.17
49 0.16
50 0.15
51 0.14
52 0.14
53 0.12
54 0.1
55 0.09
56 0.09
57 0.09
58 0.08
59 0.09
60 0.11
61 0.12
62 0.13
63 0.18
64 0.22
65 0.26
66 0.28
67 0.29
68 0.32
69 0.33
70 0.35
71 0.3
72 0.3
73 0.28
74 0.25
75 0.27
76 0.22
77 0.2
78 0.17
79 0.2
80 0.21
81 0.2
82 0.22
83 0.2
84 0.23
85 0.25
86 0.25
87 0.23
88 0.2
89 0.19
90 0.23
91 0.22
92 0.18
93 0.18
94 0.18
95 0.15
96 0.13
97 0.12
98 0.07
99 0.07
100 0.06
101 0.04
102 0.03
103 0.03
104 0.02
105 0.02
106 0.02
107 0.03
108 0.02
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.03
154 0.03
155 0.03
156 0.02
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.05
198 0.05
199 0.06
200 0.05
201 0.05
202 0.05
203 0.05
204 0.04
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.06
223 0.07
224 0.12
225 0.15
226 0.16
227 0.18
228 0.22
229 0.3
230 0.36
231 0.37
232 0.35
233 0.36
234 0.4
235 0.4
236 0.38
237 0.32
238 0.26
239 0.25
240 0.25
241 0.23
242 0.18
243 0.15
244 0.13
245 0.11
246 0.11
247 0.09
248 0.07
249 0.07
250 0.08
251 0.07
252 0.07
253 0.07
254 0.07
255 0.08
256 0.1
257 0.1
258 0.12
259 0.14
260 0.15
261 0.16
262 0.18
263 0.19
264 0.23
265 0.26
266 0.23
267 0.22
268 0.21
269 0.2
270 0.19
271 0.16
272 0.12
273 0.08
274 0.08
275 0.08
276 0.08
277 0.08
278 0.07
279 0.06
280 0.06
281 0.07
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.04
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.06
301 0.07
302 0.07
303 0.07
304 0.08
305 0.09
306 0.11
307 0.11
308 0.16
309 0.16
310 0.17
311 0.16
312 0.18
313 0.2
314 0.2
315 0.19
316 0.18
317 0.2
318 0.2
319 0.25
320 0.29
321 0.36
322 0.36
323 0.36
324 0.39
325 0.43
326 0.48
327 0.52
328 0.52
329 0.45
330 0.44
331 0.47
332 0.41
333 0.36
334 0.34
335 0.25
336 0.2
337 0.22
338 0.21
339 0.19
340 0.19
341 0.18
342 0.16
343 0.15
344 0.14
345 0.09
346 0.08
347 0.09
348 0.08
349 0.08
350 0.08
351 0.07
352 0.08
353 0.08
354 0.09
355 0.09
356 0.11
357 0.16
358 0.22
359 0.29
360 0.37
361 0.47
362 0.53
363 0.63
364 0.72
365 0.76
366 0.79
367 0.83
368 0.8
369 0.78
370 0.76