Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AK08

Protein Details
Accession D4AK08   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-30AETIRPAKSTRTRNKPPFLKKAPKPDVVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036161  RPB6/omega-like_sf  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
KEGG abe:ARB_04609  -  
Amino Acid Sequences MAETIRPAKSTRTRNKPPFLKKAPKPDVVALMVLASSLSRLYFSHPYFPADTFKMSDFGGDDHDDREETGLDYEPAEDFYDDTAVDDYAVDDQQEEGYAVLNGDGQPVTTNGENGDPNASSGQGQGKTILQQREKKVANDQRTTTPYMTNMNAPILVDLEGETDPLQIALKELNQKKIPLIIRRYLPDGWLVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.87
3 0.88
4 0.89
5 0.89
6 0.89
7 0.89
8 0.86
9 0.87
10 0.85
11 0.81
12 0.75
13 0.68
14 0.63
15 0.54
16 0.46
17 0.35
18 0.27
19 0.2
20 0.15
21 0.11
22 0.06
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.1
29 0.18
30 0.19
31 0.26
32 0.27
33 0.3
34 0.31
35 0.33
36 0.32
37 0.26
38 0.27
39 0.21
40 0.21
41 0.19
42 0.17
43 0.16
44 0.12
45 0.11
46 0.12
47 0.12
48 0.12
49 0.11
50 0.12
51 0.11
52 0.11
53 0.11
54 0.09
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.08
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.07
96 0.06
97 0.06
98 0.06
99 0.09
100 0.09
101 0.09
102 0.1
103 0.08
104 0.09
105 0.09
106 0.09
107 0.07
108 0.08
109 0.12
110 0.11
111 0.12
112 0.12
113 0.13
114 0.16
115 0.22
116 0.27
117 0.3
118 0.36
119 0.4
120 0.47
121 0.49
122 0.47
123 0.52
124 0.55
125 0.56
126 0.55
127 0.54
128 0.52
129 0.52
130 0.54
131 0.45
132 0.38
133 0.32
134 0.3
135 0.29
136 0.24
137 0.23
138 0.19
139 0.18
140 0.17
141 0.15
142 0.12
143 0.11
144 0.08
145 0.07
146 0.08
147 0.08
148 0.08
149 0.08
150 0.07
151 0.07
152 0.07
153 0.08
154 0.06
155 0.07
156 0.08
157 0.12
158 0.21
159 0.25
160 0.33
161 0.36
162 0.37
163 0.38
164 0.44
165 0.47
166 0.47
167 0.5
168 0.49
169 0.52
170 0.54
171 0.58
172 0.51
173 0.45
174 0.39