Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AQJ8

Protein Details
Accession D4AQJ8   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
107-127LELHRIPPKPFKRWNVCPALFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21, nucl 4
Family & Domain DBs
KEGG abe:ARB_06505  -  
Amino Acid Sequences MAQTEEPWLIKLHDEWISSNGSEEGVVEHDFALIIKDLLLATICPVDAARVIDTYYWDRNLDSGPLFKYHPDGVGGVEGALYEIILDAVELLSYKDNRQEDLAHLVLELHRIPPKPFKRWNVCPALFPLDYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.24
5 0.22
6 0.22
7 0.18
8 0.14
9 0.12
10 0.11
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.08
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.06
27 0.04
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.1
41 0.13
42 0.13
43 0.13
44 0.13
45 0.12
46 0.13
47 0.13
48 0.12
49 0.1
50 0.1
51 0.1
52 0.11
53 0.12
54 0.11
55 0.13
56 0.12
57 0.12
58 0.11
59 0.1
60 0.09
61 0.09
62 0.09
63 0.06
64 0.06
65 0.05
66 0.04
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.03
78 0.03
79 0.06
80 0.07
81 0.08
82 0.14
83 0.15
84 0.17
85 0.19
86 0.2
87 0.2
88 0.25
89 0.25
90 0.19
91 0.18
92 0.18
93 0.16
94 0.17
95 0.14
96 0.12
97 0.15
98 0.17
99 0.21
100 0.3
101 0.38
102 0.45
103 0.53
104 0.61
105 0.67
106 0.74
107 0.81
108 0.81
109 0.75
110 0.69
111 0.65
112 0.62