Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4APD4

Protein Details
Accession D4APD4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KAKGSPLSTKWKPRGSQKSAHydrophilic
358-378VSEWTSRYRKNDNKGIRRSGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
KEGG abe:ARB_06102  -  
Amino Acid Sequences MSKAKGSPLSTKWKPRGSQKSALSLKEKAKVLSQLGSITWQLSQLRFEKIGSLFEEEDGHFRVGSCLSRGLVDFDRDSLDELPRGPFSCENEYVDALVLGFLQHAECLQLHHHCFFAPLPTRKRYNNDREYRRACEQWNNFVTLGSKIDGSDNRTDYIVVGNFLRAIASKWTMKGAAAGPRDTNLEFTLHHPDLNVNNIFVDDDCTITCIIDWAFCSSVPLSVLLMAPGLPQSRDELEAPLIAAFEDGLSRSISTGDIISSRLRAFPSRRFLWLFYRLVSFDSSGDYSQFKEIWRLSDQNNLDFSTFFQSQQRSDSYIKKHDEMKQDDESIDRVMRREAAYFQRDMVGLTVSRKLTLVSEWTSRYRKNDNKGIRRSGSIFVADDRLWKWVLRSLEQVEGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.81
4 0.78
5 0.8
6 0.75
7 0.77
8 0.75
9 0.74
10 0.68
11 0.65
12 0.62
13 0.6
14 0.56
15 0.47
16 0.46
17 0.46
18 0.44
19 0.41
20 0.37
21 0.31
22 0.29
23 0.3
24 0.25
25 0.2
26 0.17
27 0.17
28 0.18
29 0.17
30 0.22
31 0.22
32 0.26
33 0.27
34 0.27
35 0.28
36 0.27
37 0.3
38 0.27
39 0.28
40 0.24
41 0.24
42 0.26
43 0.21
44 0.22
45 0.21
46 0.2
47 0.15
48 0.15
49 0.16
50 0.15
51 0.16
52 0.16
53 0.15
54 0.15
55 0.16
56 0.16
57 0.19
58 0.2
59 0.21
60 0.2
61 0.19
62 0.2
63 0.19
64 0.21
65 0.18
66 0.17
67 0.16
68 0.16
69 0.18
70 0.18
71 0.19
72 0.19
73 0.2
74 0.23
75 0.28
76 0.3
77 0.3
78 0.3
79 0.3
80 0.27
81 0.24
82 0.19
83 0.12
84 0.1
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.07
95 0.1
96 0.15
97 0.18
98 0.19
99 0.19
100 0.17
101 0.19
102 0.18
103 0.23
104 0.27
105 0.32
106 0.38
107 0.43
108 0.48
109 0.51
110 0.58
111 0.61
112 0.63
113 0.65
114 0.69
115 0.72
116 0.77
117 0.77
118 0.76
119 0.7
120 0.64
121 0.57
122 0.57
123 0.53
124 0.52
125 0.49
126 0.45
127 0.4
128 0.37
129 0.34
130 0.26
131 0.23
132 0.14
133 0.12
134 0.09
135 0.12
136 0.14
137 0.17
138 0.2
139 0.2
140 0.2
141 0.2
142 0.2
143 0.17
144 0.18
145 0.14
146 0.1
147 0.09
148 0.09
149 0.08
150 0.08
151 0.08
152 0.05
153 0.06
154 0.08
155 0.1
156 0.11
157 0.12
158 0.13
159 0.13
160 0.13
161 0.14
162 0.14
163 0.18
164 0.19
165 0.19
166 0.18
167 0.19
168 0.2
169 0.18
170 0.17
171 0.11
172 0.1
173 0.1
174 0.12
175 0.18
176 0.17
177 0.17
178 0.16
179 0.17
180 0.17
181 0.2
182 0.18
183 0.11
184 0.11
185 0.11
186 0.11
187 0.09
188 0.11
189 0.06
190 0.07
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.05
197 0.05
198 0.05
199 0.06
200 0.07
201 0.07
202 0.07
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.06
209 0.07
210 0.07
211 0.06
212 0.06
213 0.05
214 0.05
215 0.06
216 0.06
217 0.05
218 0.06
219 0.08
220 0.09
221 0.1
222 0.11
223 0.11
224 0.11
225 0.11
226 0.11
227 0.09
228 0.08
229 0.06
230 0.06
231 0.04
232 0.03
233 0.03
234 0.04
235 0.04
236 0.05
237 0.05
238 0.05
239 0.06
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.08
246 0.08
247 0.1
248 0.1
249 0.11
250 0.12
251 0.17
252 0.21
253 0.28
254 0.35
255 0.36
256 0.39
257 0.4
258 0.42
259 0.43
260 0.46
261 0.39
262 0.33
263 0.33
264 0.29
265 0.28
266 0.26
267 0.2
268 0.13
269 0.14
270 0.14
271 0.12
272 0.13
273 0.12
274 0.13
275 0.14
276 0.15
277 0.13
278 0.18
279 0.18
280 0.21
281 0.25
282 0.27
283 0.27
284 0.34
285 0.35
286 0.33
287 0.34
288 0.31
289 0.27
290 0.24
291 0.24
292 0.21
293 0.2
294 0.18
295 0.21
296 0.22
297 0.23
298 0.27
299 0.27
300 0.26
301 0.3
302 0.36
303 0.38
304 0.45
305 0.47
306 0.47
307 0.52
308 0.54
309 0.6
310 0.58
311 0.58
312 0.54
313 0.52
314 0.48
315 0.43
316 0.37
317 0.3
318 0.27
319 0.22
320 0.19
321 0.18
322 0.21
323 0.21
324 0.22
325 0.25
326 0.3
327 0.33
328 0.33
329 0.32
330 0.31
331 0.3
332 0.28
333 0.23
334 0.17
335 0.14
336 0.16
337 0.2
338 0.18
339 0.19
340 0.18
341 0.18
342 0.17
343 0.18
344 0.21
345 0.2
346 0.24
347 0.27
348 0.35
349 0.4
350 0.43
351 0.47
352 0.52
353 0.57
354 0.61
355 0.68
356 0.72
357 0.77
358 0.82
359 0.85
360 0.78
361 0.74
362 0.69
363 0.62
364 0.55
365 0.48
366 0.4
367 0.32
368 0.33
369 0.28
370 0.28
371 0.25
372 0.24
373 0.22
374 0.21
375 0.21
376 0.22
377 0.27
378 0.27
379 0.34
380 0.34
381 0.39