Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B307

Protein Details
Accession D4B307    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
185-209RTVIANEKKRREKEKLAEEQKREEEBasic
NLS Segment(s)
PositionSequence
192-199KKRREKEK
Subcellular Location(s) extr 9, nucl 5, plas 5, cyto 3, mito_nucl 3
Family & Domain DBs
KEGG abe:ARB_02841  -  
Amino Acid Sequences MSSLLLIIDCLLHLLVPTSPFHCHIYISTSASASPPERPESWLKAVQLGSGTNIDSHTPTPRGGVRLNKIAESWEDEDLSSEDEASDAETTITAPPAEPSTHQHHHQQGEHHHQHQVSRSGIRAPPPTPNVSRQSSCRSTTSSASCTSSGYSKRPEKQIAVATRMIGNALGHRVARSDSQKEYDRTVIANEKKRREKEKLAEEQKREEEEKAKAAIWDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.09
4 0.11
5 0.12
6 0.15
7 0.18
8 0.21
9 0.2
10 0.2
11 0.19
12 0.23
13 0.24
14 0.25
15 0.24
16 0.21
17 0.21
18 0.2
19 0.22
20 0.18
21 0.2
22 0.2
23 0.23
24 0.24
25 0.27
26 0.33
27 0.36
28 0.4
29 0.4
30 0.37
31 0.38
32 0.37
33 0.34
34 0.29
35 0.23
36 0.19
37 0.16
38 0.15
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.14
45 0.15
46 0.15
47 0.17
48 0.19
49 0.21
50 0.24
51 0.3
52 0.31
53 0.36
54 0.37
55 0.35
56 0.33
57 0.31
58 0.27
59 0.25
60 0.23
61 0.16
62 0.16
63 0.15
64 0.16
65 0.15
66 0.15
67 0.1
68 0.08
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.06
80 0.05
81 0.05
82 0.05
83 0.07
84 0.07
85 0.08
86 0.12
87 0.19
88 0.22
89 0.24
90 0.29
91 0.33
92 0.36
93 0.37
94 0.38
95 0.36
96 0.43
97 0.45
98 0.41
99 0.39
100 0.35
101 0.35
102 0.34
103 0.33
104 0.25
105 0.22
106 0.21
107 0.22
108 0.23
109 0.25
110 0.25
111 0.22
112 0.25
113 0.27
114 0.31
115 0.3
116 0.34
117 0.35
118 0.36
119 0.37
120 0.35
121 0.4
122 0.4
123 0.4
124 0.36
125 0.35
126 0.33
127 0.35
128 0.35
129 0.3
130 0.28
131 0.28
132 0.26
133 0.23
134 0.21
135 0.22
136 0.21
137 0.23
138 0.29
139 0.34
140 0.39
141 0.45
142 0.48
143 0.46
144 0.49
145 0.53
146 0.5
147 0.47
148 0.42
149 0.37
150 0.33
151 0.31
152 0.25
153 0.17
154 0.13
155 0.1
156 0.11
157 0.11
158 0.1
159 0.11
160 0.12
161 0.12
162 0.18
163 0.22
164 0.25
165 0.27
166 0.32
167 0.39
168 0.4
169 0.43
170 0.4
171 0.36
172 0.32
173 0.33
174 0.37
175 0.38
176 0.46
177 0.5
178 0.56
179 0.65
180 0.72
181 0.76
182 0.76
183 0.78
184 0.78
185 0.81
186 0.83
187 0.84
188 0.85
189 0.81
190 0.81
191 0.76
192 0.71
193 0.63
194 0.57
195 0.52
196 0.47
197 0.47
198 0.41
199 0.37