Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AZX5

Protein Details
Accession D4AZX5    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-47KGSKVQDGRVDKKKKKKKRDKEGDVAMRKEBasic
NLS Segment(s)
PositionSequence
14-39RLKIKGSKVQDGRVDKKKKKKKRDKE
90-112RRHAEAKRKRLNERLKREGVKTH
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG abe:ARB_01745  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPSSEYAVSGGGRLKIKGSKVQDGRVDKKKKKKKRDKEGDVAMRKEEAEEEKADTVVGEASNAKEEKERRSRSVSELLEGDDGKTEAERRHAEAKRKRLNERLKREGVKTHKERVEELNKYLSNLSEHHDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.23
4 0.27
5 0.33
6 0.36
7 0.41
8 0.43
9 0.5
10 0.54
11 0.58
12 0.63
13 0.65
14 0.7
15 0.69
16 0.76
17 0.8
18 0.83
19 0.86
20 0.89
21 0.9
22 0.91
23 0.95
24 0.93
25 0.92
26 0.92
27 0.91
28 0.86
29 0.76
30 0.65
31 0.54
32 0.45
33 0.35
34 0.26
35 0.18
36 0.14
37 0.13
38 0.14
39 0.14
40 0.14
41 0.13
42 0.11
43 0.09
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.08
50 0.08
51 0.08
52 0.11
53 0.13
54 0.2
55 0.3
56 0.33
57 0.34
58 0.4
59 0.42
60 0.43
61 0.49
62 0.42
63 0.34
64 0.31
65 0.28
66 0.24
67 0.22
68 0.18
69 0.09
70 0.09
71 0.07
72 0.07
73 0.09
74 0.08
75 0.14
76 0.16
77 0.19
78 0.28
79 0.34
80 0.43
81 0.5
82 0.6
83 0.63
84 0.69
85 0.72
86 0.72
87 0.78
88 0.78
89 0.8
90 0.79
91 0.78
92 0.76
93 0.73
94 0.72
95 0.7
96 0.7
97 0.66
98 0.66
99 0.62
100 0.59
101 0.59
102 0.59
103 0.6
104 0.54
105 0.51
106 0.5
107 0.47
108 0.46
109 0.44
110 0.37
111 0.29
112 0.26