Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AS78

Protein Details
Accession D4AS78   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-86GRRGGSKKEEEKREKKTPKRDGGLYKNBasic
NLS Segment(s)
PositionSequence
60-79GRRGGSKKEEEKREKKTPKR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
KEGG abe:ARB_07093  -  
Amino Acid Sequences MVAILERIAVYSARRGRYTAVVSGPDGGLADIWLFFRPQTTRYEDQPLKLVNYQPGGEEGRRGGSKKEEEKREKKTPKRDGGLYKNDAQAKMIEGKGLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.3
4 0.35
5 0.37
6 0.33
7 0.3
8 0.28
9 0.27
10 0.28
11 0.24
12 0.18
13 0.15
14 0.1
15 0.07
16 0.05
17 0.05
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.08
24 0.09
25 0.1
26 0.14
27 0.2
28 0.23
29 0.26
30 0.35
31 0.34
32 0.34
33 0.36
34 0.33
35 0.28
36 0.27
37 0.26
38 0.19
39 0.19
40 0.18
41 0.14
42 0.16
43 0.16
44 0.14
45 0.14
46 0.12
47 0.14
48 0.15
49 0.16
50 0.15
51 0.19
52 0.27
53 0.35
54 0.43
55 0.5
56 0.58
57 0.66
58 0.73
59 0.78
60 0.81
61 0.81
62 0.84
63 0.84
64 0.84
65 0.82
66 0.81
67 0.8
68 0.79
69 0.79
70 0.74
71 0.68
72 0.64
73 0.61
74 0.54
75 0.45
76 0.36
77 0.3
78 0.31
79 0.27
80 0.22