Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AS09

Protein Details
Accession D4AS09   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
349-374EILRWRTDQKYGRRQPKRRSNGLGVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009203  Knr4/Smi1  
IPR018958  Knr4/Smi1-like_dom  
IPR037883  Knr4/Smi1-like_sf  
Gene Ontology GO:0042546  P:cell wall biogenesis  
KEGG abe:ARB_07024  -  
Pfam View protein in Pfam  
PF09346  SMI1_KNR4  
Amino Acid Sequences MTSNDRHASHDSPYRTGQHVPLSQSRDAPLTSVATSAIESRPDLTNSFDEPPSLSRSSTSQNTITSPTRPYSPGMRSLSSQKLDQSSVDGGEIQMQSFHDGAPPPPPVSHSWKKIDRWVEKNYEELFDQLCEGCTQNDVNELEHELDCSLPLEVRESLQVHDGQERGGLPTGIIFGCMLLDCEEIVQEWKNWRTVNEEFLSGSTVSHPQPPLRAYGGAAASSSSAPPPPPASQQNASNPLWRQELLDRQDSQPPRAIQKAYAHPAWIPLARDWGGNNIAIDLAPGPAGKWGQVIIFGRDYDCKYVIARSWASFLATVADDLHSPHVYVDEEGGELKLKPFRQHEPPYLEILRWRTDQKYGRRQPKRRSNGLGVNTNINGKTTRDSPYGSPTPSEDRGRSPHRFPSRGPTGSPAGAMGVSSPLARVTEETSSPVNNNNITKNELDLKIQSKLRKSDDLVDLSSPVLQKPTEPFPAPETKTETSSEQATNGEAKENSPPTNDKATPSKGLDADALDDMKTVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.45
4 0.43
5 0.43
6 0.45
7 0.46
8 0.49
9 0.5
10 0.49
11 0.48
12 0.45
13 0.39
14 0.34
15 0.3
16 0.25
17 0.22
18 0.2
19 0.17
20 0.16
21 0.14
22 0.14
23 0.15
24 0.14
25 0.13
26 0.14
27 0.16
28 0.19
29 0.2
30 0.2
31 0.22
32 0.23
33 0.26
34 0.29
35 0.27
36 0.24
37 0.24
38 0.26
39 0.28
40 0.26
41 0.22
42 0.2
43 0.23
44 0.29
45 0.32
46 0.34
47 0.31
48 0.32
49 0.34
50 0.38
51 0.38
52 0.34
53 0.33
54 0.31
55 0.31
56 0.31
57 0.31
58 0.34
59 0.35
60 0.41
61 0.42
62 0.41
63 0.4
64 0.46
65 0.51
66 0.45
67 0.42
68 0.37
69 0.36
70 0.36
71 0.33
72 0.3
73 0.24
74 0.22
75 0.2
76 0.17
77 0.13
78 0.17
79 0.17
80 0.13
81 0.13
82 0.12
83 0.14
84 0.14
85 0.14
86 0.11
87 0.12
88 0.13
89 0.17
90 0.19
91 0.19
92 0.19
93 0.22
94 0.24
95 0.32
96 0.39
97 0.41
98 0.47
99 0.53
100 0.56
101 0.62
102 0.67
103 0.66
104 0.64
105 0.65
106 0.64
107 0.58
108 0.61
109 0.54
110 0.46
111 0.38
112 0.33
113 0.26
114 0.18
115 0.18
116 0.12
117 0.11
118 0.1
119 0.11
120 0.09
121 0.1
122 0.1
123 0.09
124 0.14
125 0.14
126 0.14
127 0.15
128 0.16
129 0.16
130 0.16
131 0.16
132 0.11
133 0.1
134 0.09
135 0.09
136 0.08
137 0.06
138 0.06
139 0.09
140 0.09
141 0.09
142 0.13
143 0.13
144 0.14
145 0.16
146 0.17
147 0.16
148 0.18
149 0.18
150 0.14
151 0.15
152 0.14
153 0.13
154 0.12
155 0.11
156 0.08
157 0.08
158 0.1
159 0.08
160 0.08
161 0.06
162 0.05
163 0.05
164 0.05
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.07
173 0.07
174 0.08
175 0.13
176 0.15
177 0.18
178 0.19
179 0.19
180 0.24
181 0.25
182 0.29
183 0.25
184 0.24
185 0.21
186 0.21
187 0.22
188 0.16
189 0.14
190 0.1
191 0.11
192 0.11
193 0.15
194 0.16
195 0.14
196 0.18
197 0.18
198 0.2
199 0.19
200 0.18
201 0.15
202 0.18
203 0.17
204 0.14
205 0.13
206 0.1
207 0.09
208 0.09
209 0.09
210 0.06
211 0.06
212 0.06
213 0.07
214 0.1
215 0.11
216 0.16
217 0.19
218 0.24
219 0.26
220 0.3
221 0.34
222 0.38
223 0.37
224 0.36
225 0.34
226 0.31
227 0.3
228 0.26
229 0.22
230 0.19
231 0.25
232 0.24
233 0.28
234 0.27
235 0.27
236 0.33
237 0.33
238 0.31
239 0.3
240 0.28
241 0.26
242 0.28
243 0.27
244 0.24
245 0.29
246 0.33
247 0.31
248 0.3
249 0.28
250 0.24
251 0.25
252 0.23
253 0.19
254 0.14
255 0.11
256 0.14
257 0.13
258 0.14
259 0.13
260 0.14
261 0.13
262 0.12
263 0.12
264 0.09
265 0.08
266 0.08
267 0.07
268 0.05
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.05
275 0.05
276 0.05
277 0.06
278 0.06
279 0.09
280 0.1
281 0.11
282 0.12
283 0.12
284 0.12
285 0.14
286 0.15
287 0.14
288 0.14
289 0.13
290 0.12
291 0.14
292 0.14
293 0.17
294 0.17
295 0.15
296 0.17
297 0.16
298 0.16
299 0.15
300 0.13
301 0.1
302 0.09
303 0.09
304 0.07
305 0.07
306 0.07
307 0.07
308 0.09
309 0.08
310 0.08
311 0.08
312 0.08
313 0.08
314 0.09
315 0.09
316 0.07
317 0.07
318 0.07
319 0.07
320 0.07
321 0.06
322 0.08
323 0.11
324 0.13
325 0.17
326 0.21
327 0.27
328 0.36
329 0.43
330 0.49
331 0.51
332 0.52
333 0.53
334 0.5
335 0.44
336 0.39
337 0.35
338 0.31
339 0.27
340 0.28
341 0.24
342 0.31
343 0.38
344 0.44
345 0.52
346 0.58
347 0.67
348 0.75
349 0.82
350 0.85
351 0.88
352 0.88
353 0.85
354 0.83
355 0.81
356 0.79
357 0.75
358 0.71
359 0.62
360 0.55
361 0.47
362 0.42
363 0.34
364 0.26
365 0.21
366 0.16
367 0.17
368 0.17
369 0.21
370 0.21
371 0.23
372 0.24
373 0.31
374 0.35
375 0.33
376 0.31
377 0.29
378 0.33
379 0.36
380 0.39
381 0.32
382 0.33
383 0.39
384 0.46
385 0.48
386 0.47
387 0.51
388 0.56
389 0.58
390 0.55
391 0.57
392 0.59
393 0.56
394 0.53
395 0.48
396 0.43
397 0.4
398 0.38
399 0.28
400 0.19
401 0.16
402 0.15
403 0.1
404 0.07
405 0.07
406 0.06
407 0.06
408 0.06
409 0.07
410 0.07
411 0.08
412 0.1
413 0.13
414 0.14
415 0.16
416 0.17
417 0.19
418 0.19
419 0.23
420 0.23
421 0.24
422 0.27
423 0.29
424 0.3
425 0.32
426 0.31
427 0.3
428 0.33
429 0.3
430 0.29
431 0.29
432 0.3
433 0.34
434 0.38
435 0.4
436 0.41
437 0.47
438 0.5
439 0.52
440 0.52
441 0.53
442 0.56
443 0.55
444 0.5
445 0.44
446 0.39
447 0.32
448 0.32
449 0.24
450 0.17
451 0.15
452 0.13
453 0.15
454 0.19
455 0.25
456 0.29
457 0.31
458 0.33
459 0.36
460 0.46
461 0.46
462 0.46
463 0.47
464 0.42
465 0.43
466 0.43
467 0.4
468 0.33
469 0.35
470 0.31
471 0.26
472 0.24
473 0.23
474 0.24
475 0.22
476 0.24
477 0.2
478 0.2
479 0.27
480 0.3
481 0.3
482 0.31
483 0.35
484 0.35
485 0.44
486 0.44
487 0.41
488 0.45
489 0.49
490 0.51
491 0.5
492 0.51
493 0.43
494 0.43
495 0.4
496 0.33
497 0.3
498 0.26
499 0.23
500 0.17
501 0.17