Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AJ02

Protein Details
Accession D4AJ02   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-133AENPTSQRPKRRSWDVRRSKVEVRRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
KEGG abe:ARB_04250  -  
Amino Acid Sequences MRDYPALLYQQLFFFANKVISYHGSQIDSYQRPSMAEKRSVWSGRELSVCVRSSGCFMSFTIEKRSEGFKKQYTAVVGLQSRQHSTADSSSSAGLPEAADKGHAESEAENPTSQRPKRRSWDVRRSKVEVRRSESEDEVTVTLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.14
5 0.14
6 0.15
7 0.16
8 0.18
9 0.21
10 0.22
11 0.21
12 0.21
13 0.23
14 0.29
15 0.28
16 0.29
17 0.27
18 0.24
19 0.24
20 0.29
21 0.33
22 0.31
23 0.34
24 0.34
25 0.36
26 0.42
27 0.43
28 0.4
29 0.38
30 0.34
31 0.31
32 0.3
33 0.28
34 0.23
35 0.26
36 0.25
37 0.2
38 0.19
39 0.17
40 0.17
41 0.17
42 0.16
43 0.11
44 0.11
45 0.13
46 0.14
47 0.16
48 0.2
49 0.2
50 0.19
51 0.2
52 0.25
53 0.25
54 0.28
55 0.32
56 0.29
57 0.3
58 0.31
59 0.32
60 0.27
61 0.27
62 0.23
63 0.21
64 0.18
65 0.17
66 0.19
67 0.18
68 0.18
69 0.16
70 0.16
71 0.12
72 0.14
73 0.15
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.12
80 0.1
81 0.08
82 0.06
83 0.06
84 0.06
85 0.05
86 0.06
87 0.06
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.12
94 0.15
95 0.16
96 0.15
97 0.15
98 0.2
99 0.29
100 0.32
101 0.38
102 0.4
103 0.48
104 0.57
105 0.68
106 0.73
107 0.75
108 0.82
109 0.84
110 0.89
111 0.87
112 0.85
113 0.83
114 0.8
115 0.79
116 0.76
117 0.73
118 0.69
119 0.67
120 0.65
121 0.59
122 0.53
123 0.45
124 0.38