Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AMV5

Protein Details
Accession D4AMV5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-82PFPPADIGKKKKWKRGKEDESMGKNTBasic
NLS Segment(s)
PositionSequence
61-73ADIGKKKKWKRGK
Subcellular Location(s) cyto 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abe:ARB_05558  -  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
Amino Acid Sequences MSTFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKRMHAPFPPADIGKKKKWKRGKEDESMGKNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.11
11 0.12
12 0.12
13 0.11
14 0.17
15 0.23
16 0.24
17 0.23
18 0.21
19 0.21
20 0.23
21 0.23
22 0.17
23 0.12
24 0.11
25 0.11
26 0.11
27 0.09
28 0.08
29 0.09
30 0.08
31 0.08
32 0.07
33 0.08
34 0.08
35 0.08
36 0.13
37 0.13
38 0.14
39 0.2
40 0.25
41 0.32
42 0.34
43 0.41
44 0.36
45 0.39
46 0.42
47 0.35
48 0.36
49 0.37
50 0.41
51 0.44
52 0.54
53 0.57
54 0.64
55 0.73
56 0.78
57 0.81
58 0.86
59 0.86
60 0.85
61 0.88
62 0.88