Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4B3Z5

Protein Details
Accession D4B3Z5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-45IGLFATFPKTKKKKKNAVKKERKKEEKKKRKKQTKGEEEARTPBasic
NLS Segment(s)
PositionSequence
11-38KTKKKKKNAVKKERKKEEKKKRKKQTKG
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG abe:ARB_03184  -  
Amino Acid Sequences MYIGLFATFPKTKKKKKNAVKKERKKEEKKKRKKQTKGEEEARTPGEQQRGNAARQLGKADGSRPEGNVTPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.81
4 0.9
5 0.91
6 0.93
7 0.94
8 0.94
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.95
15 0.94
16 0.95
17 0.95
18 0.95
19 0.95
20 0.94
21 0.93
22 0.93
23 0.92
24 0.9
25 0.88
26 0.82
27 0.73
28 0.66
29 0.57
30 0.46
31 0.37
32 0.31
33 0.29
34 0.25
35 0.24
36 0.3
37 0.31
38 0.31
39 0.33
40 0.32
41 0.29
42 0.29
43 0.31
44 0.23
45 0.23
46 0.24
47 0.24
48 0.26
49 0.29
50 0.29
51 0.28
52 0.3