Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4ATT0

Protein Details
Accession D4ATT0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAVKKDAGRGRSKKRPRDNPGQLVSQHydrophilic
NLS Segment(s)
PositionSequence
5-17KDAGRGRSKKRPR
Subcellular Location(s) mito 14, nucl 6, cyto 5
Family & Domain DBs
KEGG abe:ARB_07646  -  
Amino Acid Sequences MAVKKDAGRGRSKKRPRDNPGQLVSQLTAGLSSGSSCVFDAVTGAEPAVVLLDQPGVGVDQRCSWGMLGDAGCYSYIDGDGDEVDGDGYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.87
4 0.89
5 0.89
6 0.87
7 0.82
8 0.75
9 0.65
10 0.56
11 0.48
12 0.37
13 0.26
14 0.16
15 0.12
16 0.08
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.05
28 0.05
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.02
38 0.02
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.05
46 0.06
47 0.07
48 0.09
49 0.1
50 0.1
51 0.1
52 0.1
53 0.09
54 0.12
55 0.11
56 0.1
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06