Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AWK7

Protein Details
Accession D4AWK7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-70EEEKKEEEQQPRRRRRREEEKKKKKKNLQKRKGKDGAGBasic
NLS Segment(s)
PositionSequence
42-70QPRRRRRREEEKKKKKKNLQKRKGKDGAG
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG abe:ARB_00573  -  
Amino Acid Sequences MRLVYNGVQGGREECSFGAGDGSKRARQSTAEEEEKKEEEQQPRRRRRREEEKKKKKKNLQKRKGKDGAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.12
6 0.11
7 0.12
8 0.16
9 0.19
10 0.2
11 0.21
12 0.22
13 0.21
14 0.21
15 0.26
16 0.28
17 0.31
18 0.36
19 0.36
20 0.37
21 0.38
22 0.38
23 0.33
24 0.3
25 0.29
26 0.3
27 0.39
28 0.47
29 0.55
30 0.65
31 0.75
32 0.79
33 0.83
34 0.84
35 0.86
36 0.88
37 0.89
38 0.89
39 0.91
40 0.94
41 0.96
42 0.96
43 0.95
44 0.95
45 0.94
46 0.94
47 0.94
48 0.94
49 0.93
50 0.93