Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AQ41

Protein Details
Accession D4AQ41    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TSPEFQRKFKWIKKLGNGSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
KEGG abe:ARB_06348  -  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MDPTKDTSPEFQRKFKWIKKLGNGSFGAVYLFESRITREKFACKVAVDPGAQEALLREVAILKRLHHVSVNFCILAPELATDIIQAEYYRVRYQPFLSQSKTKLFDYGVPSPWLAGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.69
4 0.67
5 0.71
6 0.74
7 0.8
8 0.75
9 0.72
10 0.66
11 0.57
12 0.48
13 0.39
14 0.29
15 0.19
16 0.17
17 0.1
18 0.1
19 0.09
20 0.09
21 0.11
22 0.18
23 0.21
24 0.22
25 0.23
26 0.28
27 0.29
28 0.32
29 0.33
30 0.26
31 0.25
32 0.25
33 0.26
34 0.21
35 0.18
36 0.16
37 0.13
38 0.13
39 0.11
40 0.08
41 0.06
42 0.06
43 0.05
44 0.04
45 0.06
46 0.06
47 0.1
48 0.11
49 0.1
50 0.15
51 0.16
52 0.16
53 0.17
54 0.18
55 0.18
56 0.21
57 0.22
58 0.18
59 0.17
60 0.17
61 0.15
62 0.13
63 0.1
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.05
73 0.06
74 0.08
75 0.11
76 0.13
77 0.14
78 0.15
79 0.17
80 0.2
81 0.27
82 0.32
83 0.35
84 0.39
85 0.43
86 0.46
87 0.51
88 0.52
89 0.45
90 0.41
91 0.37
92 0.38
93 0.39
94 0.41
95 0.37
96 0.35
97 0.34
98 0.32