Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B1R5

Protein Details
Accession D4B1R5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
282-306GLTPPLRWVRKRRFRKRISNRTIEAHydrophilic
NLS Segment(s)
PositionSequence
51-144KLKLGLKQPAPQPEQKQTPAKAKKAASTKTPKETPASSSSKKRSRDAAADTNGKASGAAAPAEGAPIKRFKLTAKPKQPTSLRIKNKGAPPVRP
291-298RKRRFRKR
Subcellular Location(s) mito 11.5, nucl 10.5, cyto_mito 8.333, cyto_nucl 7.833, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
KEGG abe:ARB_02396  -  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MAGRQILKLTIGKKAAQPSQSSQAAPQPSQKSPTPPPPSASSTPAAAPKLKLKLGLKQPAPQPEQKQTPAKAKKAASTKTPKETPASSSSKKRSRDAAADTNGKASGAAAPAEGAPIKRFKLTAKPKQPTSLRIKNKGAPPVRPRGSGYDSEASDTEIDPALEEEFILRMEPGDDCEYLRKAIEEKRFGPRSLGGADVSFKSLTRDGRRATVTIRGNIYAATLVDLPAIIEGLKSWDKRGWYKAADICQMLLVLGKVKTEEEAHHYPLPKDVDPATFQYAHGLTPPLRWVRKRRFRKRISNRTIEAVELEVARLLKEDMAAIKPPDFEIMDQSQYARENQTEQDGFEEYDDEQDAEGEFFDESQQYEEQQYEEPMEMDDDLAAEMEAELAAHADAGSVPASATPDVSHTGEDSHEPDAEGELEIGTPQTPHTPLHPPVESSGDEDESGMSAAEDANEDLDQDALEQQRQLQEQLEEIAELEADVQAETRRWEEMNNPILKAKLGKRVQNLKQALELKKVSIGGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.46
4 0.49
5 0.47
6 0.52
7 0.53
8 0.49
9 0.44
10 0.44
11 0.45
12 0.42
13 0.45
14 0.43
15 0.42
16 0.47
17 0.48
18 0.49
19 0.52
20 0.6
21 0.6
22 0.57
23 0.58
24 0.59
25 0.63
26 0.58
27 0.55
28 0.46
29 0.4
30 0.39
31 0.4
32 0.37
33 0.32
34 0.31
35 0.34
36 0.38
37 0.37
38 0.41
39 0.39
40 0.45
41 0.52
42 0.58
43 0.55
44 0.56
45 0.6
46 0.63
47 0.65
48 0.64
49 0.61
50 0.61
51 0.65
52 0.65
53 0.68
54 0.64
55 0.69
56 0.71
57 0.7
58 0.68
59 0.64
60 0.64
61 0.65
62 0.64
63 0.63
64 0.64
65 0.66
66 0.67
67 0.68
68 0.63
69 0.59
70 0.57
71 0.52
72 0.5
73 0.51
74 0.48
75 0.54
76 0.61
77 0.64
78 0.66
79 0.65
80 0.64
81 0.62
82 0.64
83 0.63
84 0.62
85 0.61
86 0.62
87 0.58
88 0.52
89 0.45
90 0.37
91 0.29
92 0.2
93 0.15
94 0.11
95 0.1
96 0.08
97 0.09
98 0.09
99 0.1
100 0.1
101 0.09
102 0.1
103 0.13
104 0.14
105 0.15
106 0.16
107 0.18
108 0.28
109 0.38
110 0.47
111 0.55
112 0.61
113 0.63
114 0.71
115 0.72
116 0.7
117 0.69
118 0.69
119 0.67
120 0.68
121 0.7
122 0.68
123 0.7
124 0.7
125 0.65
126 0.64
127 0.62
128 0.63
129 0.61
130 0.57
131 0.54
132 0.5
133 0.5
134 0.44
135 0.43
136 0.37
137 0.34
138 0.33
139 0.31
140 0.25
141 0.21
142 0.19
143 0.14
144 0.1
145 0.09
146 0.08
147 0.08
148 0.07
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.08
160 0.1
161 0.1
162 0.11
163 0.14
164 0.15
165 0.15
166 0.15
167 0.13
168 0.14
169 0.21
170 0.28
171 0.3
172 0.33
173 0.42
174 0.45
175 0.44
176 0.43
177 0.38
178 0.33
179 0.29
180 0.27
181 0.18
182 0.15
183 0.16
184 0.14
185 0.14
186 0.11
187 0.1
188 0.1
189 0.13
190 0.18
191 0.22
192 0.27
193 0.27
194 0.31
195 0.33
196 0.32
197 0.3
198 0.33
199 0.31
200 0.29
201 0.28
202 0.24
203 0.23
204 0.21
205 0.2
206 0.13
207 0.09
208 0.07
209 0.06
210 0.06
211 0.05
212 0.05
213 0.05
214 0.04
215 0.04
216 0.03
217 0.03
218 0.03
219 0.06
220 0.1
221 0.1
222 0.11
223 0.13
224 0.16
225 0.2
226 0.24
227 0.26
228 0.24
229 0.29
230 0.31
231 0.33
232 0.33
233 0.29
234 0.25
235 0.2
236 0.18
237 0.13
238 0.1
239 0.07
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.07
246 0.08
247 0.09
248 0.14
249 0.16
250 0.2
251 0.22
252 0.23
253 0.23
254 0.26
255 0.27
256 0.21
257 0.2
258 0.18
259 0.17
260 0.17
261 0.2
262 0.18
263 0.16
264 0.16
265 0.16
266 0.15
267 0.13
268 0.12
269 0.12
270 0.09
271 0.1
272 0.14
273 0.17
274 0.2
275 0.25
276 0.34
277 0.43
278 0.54
279 0.64
280 0.71
281 0.77
282 0.84
283 0.9
284 0.92
285 0.93
286 0.91
287 0.88
288 0.79
289 0.72
290 0.63
291 0.51
292 0.41
293 0.3
294 0.21
295 0.13
296 0.11
297 0.07
298 0.07
299 0.06
300 0.06
301 0.06
302 0.05
303 0.05
304 0.06
305 0.06
306 0.08
307 0.1
308 0.1
309 0.11
310 0.11
311 0.11
312 0.12
313 0.11
314 0.1
315 0.13
316 0.14
317 0.15
318 0.14
319 0.15
320 0.15
321 0.15
322 0.16
323 0.13
324 0.12
325 0.13
326 0.14
327 0.19
328 0.18
329 0.17
330 0.18
331 0.17
332 0.17
333 0.14
334 0.15
335 0.09
336 0.1
337 0.1
338 0.08
339 0.07
340 0.07
341 0.07
342 0.06
343 0.06
344 0.05
345 0.05
346 0.05
347 0.05
348 0.06
349 0.06
350 0.08
351 0.08
352 0.09
353 0.1
354 0.1
355 0.11
356 0.12
357 0.12
358 0.11
359 0.11
360 0.1
361 0.1
362 0.1
363 0.08
364 0.07
365 0.07
366 0.05
367 0.05
368 0.05
369 0.04
370 0.04
371 0.03
372 0.03
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.03
381 0.03
382 0.04
383 0.05
384 0.04
385 0.04
386 0.05
387 0.07
388 0.07
389 0.07
390 0.07
391 0.08
392 0.11
393 0.12
394 0.12
395 0.11
396 0.12
397 0.12
398 0.14
399 0.14
400 0.13
401 0.13
402 0.13
403 0.13
404 0.13
405 0.12
406 0.11
407 0.09
408 0.07
409 0.07
410 0.06
411 0.06
412 0.06
413 0.05
414 0.06
415 0.09
416 0.1
417 0.11
418 0.15
419 0.23
420 0.27
421 0.33
422 0.34
423 0.33
424 0.33
425 0.36
426 0.33
427 0.29
428 0.27
429 0.21
430 0.2
431 0.19
432 0.17
433 0.13
434 0.12
435 0.09
436 0.06
437 0.05
438 0.05
439 0.05
440 0.06
441 0.06
442 0.07
443 0.07
444 0.07
445 0.07
446 0.07
447 0.06
448 0.06
449 0.1
450 0.11
451 0.12
452 0.12
453 0.15
454 0.2
455 0.21
456 0.22
457 0.22
458 0.21
459 0.21
460 0.23
461 0.21
462 0.16
463 0.15
464 0.13
465 0.1
466 0.09
467 0.08
468 0.06
469 0.06
470 0.06
471 0.06
472 0.07
473 0.09
474 0.11
475 0.12
476 0.14
477 0.14
478 0.16
479 0.21
480 0.29
481 0.37
482 0.38
483 0.38
484 0.38
485 0.38
486 0.38
487 0.41
488 0.37
489 0.39
490 0.42
491 0.48
492 0.56
493 0.66
494 0.72
495 0.74
496 0.73
497 0.65
498 0.67
499 0.68
500 0.62
501 0.6
502 0.53
503 0.45
504 0.44
505 0.45