FuNGI

D4B1R5

Protein Details

Accession

D4B1R5

Localization Confidence

Medium

Confidence Score

12.5

NoLS Segment(s)

Position	Sequence	Protein Nature
282-306	GLTPPLRWVRKRRFRKRISNRTIEA	Hydrophilic

NLS Segment(s)

Position	Sequence
51-144	KLKLGLKQPAPQPEQKQTPAKAKKAASTKTPKETPASSSSKKRSRDAAADTNGKASGAAAPAEGAPIKRFKLTAKPKQPTSLRIKNKGAPPVRP
291-298	RKRRFRKR

Subcellular Location(s)

mito 11.5, nucl 10.5, cyto_mito 8.333, cyto_nucl 7.833, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0003743 F:translation initiation factor activity GO:0006367 P:transcription initiation at RNA polymerase II promoter
KEGG	abe:ARB_02396 -
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MAGRQILKLTIGKKAAQPSQSSQAAPQPSQKSPTPPPPSASSTPAAAPKLKLKLGLKQPAPQPEQKQTPAKAKKAASTKTPKETPASSSSKKRSRDAAADTNGKASGAAAPAEGAPIKRFKLTAKPKQPTSLRIKNKGAPPVRPRGSGYDSEASDTEIDPALEEEFILRMEPGDDCEYLRKAIEEKRFGPRSLGGADVSFKSLTRDGRRATVTIRGNIYAATLVDLPAIIEGLKSWDKRGWYKAADICQMLLVLGKVKTEEEAHHYPLPKDVDPATFQYAHGLTPPLRWVRKRRFRKRISNRTIEAVELEVARLLKEDMAAIKPPDFEIMDQSQYARENQTEQDGFEEYDDEQDAEGEFFDESQQYEEQQYEEPMEMDDDLAAEMEAELAAHADAGSVPASATPDVSHTGEDSHEPDAEGELEIGTPQTPHTPLHPPVESSGDEDESGMSAAEDANEDLDQDALEQQRQLQEQLEEIAELEADVQAETRRWEEMNNPILKAKLGKRVQNLKQALELKKVSIGGRG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.46
3	0.46
4	0.49
5	0.47
6	0.52
7	0.53
8	0.49
9	0.44
10	0.44
11	0.45
12	0.42
13	0.45
14	0.43
15	0.42
16	0.47
17	0.48
18	0.49
19	0.52
20	0.6
21	0.6
22	0.57
23	0.58
24	0.59
25	0.63
26	0.58
27	0.55
28	0.46
29	0.4
30	0.39
31	0.4
32	0.37
33	0.32
34	0.31
35	0.34
36	0.38
37	0.37
38	0.41
39	0.39
40	0.45
41	0.52
42	0.58
43	0.55
44	0.56
45	0.6
46	0.63
47	0.65
48	0.64
49	0.61
50	0.61
51	0.65
52	0.65
53	0.68
54	0.64
55	0.69
56	0.71
57	0.7
58	0.68
59	0.64
60	0.64
61	0.65
62	0.64
63	0.63
64	0.64
65	0.66
66	0.67
67	0.68
68	0.63
69	0.59
70	0.57
71	0.52
72	0.5
73	0.51
74	0.48
75	0.54
76	0.61
77	0.64
78	0.66
79	0.65
80	0.64
81	0.62
82	0.64
83	0.63
84	0.62
85	0.61
86	0.62
87	0.58
88	0.52
89	0.45
90	0.37
91	0.29
92	0.2
93	0.15
94	0.11
95	0.1
96	0.08
97	0.09
98	0.09
99	0.1
100	0.1
101	0.09
102	0.1
103	0.13
104	0.14
105	0.15
106	0.16
107	0.18
108	0.28
109	0.38
110	0.47
111	0.55
112	0.61
113	0.63
114	0.71
115	0.72
116	0.7
117	0.69
118	0.69
119	0.67
120	0.68
121	0.7
122	0.68
123	0.7
124	0.7
125	0.65
126	0.64
127	0.62
128	0.63
129	0.61
130	0.57
131	0.54
132	0.5
133	0.5
134	0.44
135	0.43
136	0.37
137	0.34
138	0.33
139	0.31
140	0.25
141	0.21
142	0.19
143	0.14
144	0.1
145	0.09
146	0.08
147	0.08
148	0.07
149	0.07
150	0.06
151	0.05
152	0.05
153	0.05
154	0.05
155	0.05
156	0.04
157	0.05
158	0.05
159	0.08
160	0.1
161	0.1
162	0.11
163	0.14
164	0.15
165	0.15
166	0.15
167	0.13
168	0.14
169	0.21
170	0.28
171	0.3
172	0.33
173	0.42
174	0.45
175	0.44
176	0.43
177	0.38
178	0.33
179	0.29
180	0.27
181	0.18
182	0.15
183	0.16
184	0.14
185	0.14
186	0.11
187	0.1
188	0.1
189	0.13
190	0.18
191	0.22
192	0.27
193	0.27
194	0.31
195	0.33
196	0.32
197	0.3
198	0.33
199	0.31
200	0.29
201	0.28
202	0.24
203	0.23
204	0.21
205	0.2
206	0.13
207	0.09
208	0.07
209	0.06
210	0.06
211	0.05
212	0.05
213	0.05
214	0.04
215	0.04
216	0.03
217	0.03
218	0.03
219	0.06
220	0.1
221	0.1
222	0.11
223	0.13
224	0.16
225	0.2
226	0.24
227	0.26
228	0.24
229	0.29
230	0.31
231	0.33
232	0.33
233	0.29
234	0.25
235	0.2
236	0.18
237	0.13
238	0.1
239	0.07
240	0.06
241	0.06
242	0.06
243	0.06
244	0.06
245	0.07
246	0.08
247	0.09
248	0.14
249	0.16
250	0.2
251	0.22
252	0.23
253	0.23
254	0.26
255	0.27
256	0.21
257	0.2
258	0.18
259	0.17
260	0.17
261	0.2
262	0.18
263	0.16
264	0.16
265	0.16
266	0.15
267	0.13
268	0.12
269	0.12
270	0.09
271	0.1
272	0.14
273	0.17
274	0.2
275	0.25
276	0.34
277	0.43
278	0.54
279	0.64
280	0.71
281	0.77
282	0.84
283	0.9
284	0.92
285	0.93
286	0.91
287	0.88
288	0.79
289	0.72
290	0.63
291	0.51
292	0.41
293	0.3
294	0.21
295	0.13
296	0.11
297	0.07
298	0.07
299	0.06
300	0.06
301	0.06
302	0.05
303	0.05
304	0.06
305	0.06
306	0.08
307	0.1
308	0.1
309	0.11
310	0.11
311	0.11
312	0.12
313	0.11
314	0.1
315	0.13
316	0.14
317	0.15
318	0.14
319	0.15
320	0.15
321	0.15
322	0.16
323	0.13
324	0.12
325	0.13
326	0.14
327	0.19
328	0.18
329	0.17
330	0.18
331	0.17
332	0.17
333	0.14
334	0.15
335	0.09
336	0.1
337	0.1
338	0.08
339	0.07
340	0.07
341	0.07
342	0.06
343	0.06
344	0.05
345	0.05
346	0.05
347	0.05
348	0.06
349	0.06
350	0.08
351	0.08
352	0.09
353	0.1
354	0.1
355	0.11
356	0.12
357	0.12
358	0.11
359	0.11
360	0.1
361	0.1
362	0.1
363	0.08
364	0.07
365	0.07
366	0.05
367	0.05
368	0.05
369	0.04
370	0.04
371	0.03
372	0.03
373	0.03
374	0.03
375	0.03
376	0.03
377	0.03
378	0.03
379	0.03
380	0.03
381	0.03
382	0.04
383	0.05
384	0.04
385	0.04
386	0.05
387	0.07
388	0.07
389	0.07
390	0.07
391	0.08
392	0.11
393	0.12
394	0.12
395	0.11
396	0.12
397	0.12
398	0.14
399	0.14
400	0.13
401	0.13
402	0.13
403	0.13
404	0.13
405	0.12
406	0.11
407	0.09
408	0.07
409	0.07
410	0.06
411	0.06
412	0.06
413	0.05
414	0.06
415	0.09
416	0.1
417	0.11
418	0.15
419	0.23
420	0.27
421	0.33
422	0.34
423	0.33
424	0.33
425	0.36
426	0.33
427	0.29
428	0.27
429	0.21
430	0.2
431	0.19
432	0.17
433	0.13
434	0.12
435	0.09
436	0.06
437	0.05
438	0.05
439	0.05
440	0.06
441	0.06
442	0.07
443	0.07
444	0.07
445	0.07
446	0.07
447	0.06
448	0.06
449	0.1
450	0.11
451	0.12
452	0.12
453	0.15
454	0.2
455	0.21
456	0.22
457	0.22
458	0.21
459	0.21
460	0.23
461	0.21
462	0.16
463	0.15
464	0.13
465	0.1
466	0.09
467	0.08
468	0.06
469	0.06
470	0.06
471	0.06
472	0.07
473	0.09
474	0.11
475	0.12
476	0.14
477	0.14
478	0.16
479	0.21
480	0.29
481	0.37
482	0.38
483	0.38
484	0.38
485	0.38
486	0.38
487	0.41
488	0.37
489	0.39
490	0.42
491	0.48
492	0.56
493	0.66
494	0.72
495	0.74
496	0.73
497	0.65
498	0.67
499	0.68
500	0.62
501	0.6
502	0.53
503	0.45
504	0.44
505	0.45

D4B1R5

3D AlphaFold-predicted Structure Viewer