Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AMR2

Protein Details
Accession D4AMR2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-42EGEAVEKKLKQEKKKKKKKKERERKRTSRNPGRRQASRBasic
NLS Segment(s)
PositionSequence
11-39KKLKQEKKKKKKKKERERKRTSRNPGRRQ
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
KEGG abe:ARB_05515  -  
Amino Acid Sequences MADDEGEAVEKKLKQEKKKKKKKKERERKRTSRNPGRRQASRGITLFLLAATSTSFFPPPQIAMIIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.55
3 0.65
4 0.72
5 0.82
6 0.89
7 0.92
8 0.95
9 0.96
10 0.97
11 0.97
12 0.97
13 0.97
14 0.97
15 0.96
16 0.96
17 0.94
18 0.94
19 0.93
20 0.93
21 0.91
22 0.89
23 0.85
24 0.79
25 0.73
26 0.7
27 0.63
28 0.58
29 0.49
30 0.41
31 0.33
32 0.29
33 0.25
34 0.17
35 0.12
36 0.07
37 0.06
38 0.05
39 0.06
40 0.06
41 0.08
42 0.09
43 0.09
44 0.11
45 0.13
46 0.14
47 0.14