Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4ANS8

Protein Details
Accession D4ANS8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-148VSEVRRRKPFHKRYMKKGDDGBasic
NLS Segment(s)
PositionSequence
132-140RRRKPFHKR
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
Gene Ontology GO:0016740  F:transferase activity  
KEGG abe:ARB_05895  -  
Amino Acid Sequences MLGANETTIEGWEIERHRTLCRRARALGGYLEGPDGVKVWIKKQEFPYDIGVWNNIRDGMGGSNNSTILMSEDESLIWPPPDPDRMSRNTPQRQDRTTLLGDGQNFDYDEIEAFHKRQEADYLRQRAVSEVRRRKPFHKRYMKKGDDGHLSNISDSEDEELSNSGEEGWRNSEGERLKDFGVDEEVEFYDEDDIPLAELIRRKKLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.25
4 0.31
5 0.38
6 0.46
7 0.5
8 0.57
9 0.59
10 0.57
11 0.62
12 0.59
13 0.55
14 0.48
15 0.42
16 0.33
17 0.28
18 0.25
19 0.19
20 0.15
21 0.12
22 0.09
23 0.08
24 0.11
25 0.11
26 0.15
27 0.23
28 0.25
29 0.31
30 0.37
31 0.46
32 0.44
33 0.46
34 0.47
35 0.42
36 0.41
37 0.36
38 0.33
39 0.24
40 0.23
41 0.2
42 0.15
43 0.12
44 0.1
45 0.1
46 0.09
47 0.11
48 0.11
49 0.12
50 0.12
51 0.12
52 0.12
53 0.11
54 0.09
55 0.07
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.07
65 0.06
66 0.07
67 0.09
68 0.12
69 0.13
70 0.16
71 0.21
72 0.25
73 0.31
74 0.36
75 0.44
76 0.48
77 0.53
78 0.58
79 0.59
80 0.57
81 0.54
82 0.5
83 0.45
84 0.38
85 0.32
86 0.25
87 0.21
88 0.19
89 0.17
90 0.15
91 0.11
92 0.1
93 0.09
94 0.08
95 0.06
96 0.06
97 0.06
98 0.08
99 0.08
100 0.08
101 0.09
102 0.11
103 0.11
104 0.11
105 0.17
106 0.19
107 0.26
108 0.34
109 0.38
110 0.36
111 0.37
112 0.37
113 0.33
114 0.34
115 0.36
116 0.38
117 0.43
118 0.5
119 0.58
120 0.62
121 0.68
122 0.73
123 0.75
124 0.75
125 0.77
126 0.77
127 0.79
128 0.87
129 0.83
130 0.78
131 0.73
132 0.68
133 0.64
134 0.59
135 0.52
136 0.45
137 0.41
138 0.35
139 0.3
140 0.24
141 0.17
142 0.14
143 0.12
144 0.08
145 0.08
146 0.09
147 0.09
148 0.09
149 0.08
150 0.08
151 0.06
152 0.08
153 0.08
154 0.1
155 0.13
156 0.14
157 0.14
158 0.15
159 0.2
160 0.22
161 0.26
162 0.27
163 0.25
164 0.24
165 0.25
166 0.26
167 0.22
168 0.22
169 0.18
170 0.16
171 0.16
172 0.16
173 0.15
174 0.15
175 0.13
176 0.12
177 0.11
178 0.11
179 0.09
180 0.09
181 0.08
182 0.09
183 0.09
184 0.1
185 0.15
186 0.2
187 0.29