Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B402

Protein Details
Accession D4B402   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-48RSRSNSPPQVHPSKRRKMGASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR043359  GLI-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005634  C:nucleus  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG abe:ARB_03191  -  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAESPASPLSSLASEEFPEDVKFEDQGRSRSNSPPQVHPSKRRKMGASTWDHHTPISSVNDDIPPPSPVASISSDSSGAIPNSPGAMAILGPEEDYSGAGRDHITACLWEGCGAKDFVDMDALVKHIHDEHIGSRQKKYLCEWGDCARKGQAHASGYALRAHMRSHTKEKPFYCALPVHDTDALKSLDALAKQHANPTAPGISKPPRIKLKLAPRKENDNAEKLDGSEQKGDQGKTKDQGDIPIFDPEVGFDEHELAMPLEQLARLLRRQIHWAEQESKTLEKNWELIKPMRKKTWKEKELILDDLIHSEIRVYGTPHTQEQDPPRYGGTQKVTTDRTKKPPSQDKGGTEEADGGDEQPGEQTRPQAQTSKMKSHTDDGQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.14
6 0.13
7 0.14
8 0.14
9 0.15
10 0.16
11 0.23
12 0.26
13 0.32
14 0.36
15 0.39
16 0.41
17 0.46
18 0.53
19 0.56
20 0.56
21 0.58
22 0.62
23 0.68
24 0.74
25 0.77
26 0.78
27 0.79
28 0.83
29 0.81
30 0.77
31 0.74
32 0.74
33 0.73
34 0.72
35 0.66
36 0.63
37 0.61
38 0.57
39 0.49
40 0.41
41 0.32
42 0.28
43 0.28
44 0.23
45 0.2
46 0.21
47 0.24
48 0.23
49 0.23
50 0.2
51 0.17
52 0.16
53 0.15
54 0.13
55 0.12
56 0.14
57 0.16
58 0.17
59 0.17
60 0.17
61 0.17
62 0.17
63 0.17
64 0.16
65 0.13
66 0.12
67 0.11
68 0.1
69 0.1
70 0.09
71 0.09
72 0.07
73 0.06
74 0.05
75 0.06
76 0.06
77 0.05
78 0.06
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.09
89 0.1
90 0.1
91 0.1
92 0.09
93 0.11
94 0.11
95 0.11
96 0.12
97 0.12
98 0.12
99 0.13
100 0.13
101 0.12
102 0.12
103 0.12
104 0.1
105 0.1
106 0.09
107 0.08
108 0.08
109 0.09
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.09
118 0.18
119 0.25
120 0.26
121 0.27
122 0.32
123 0.33
124 0.34
125 0.36
126 0.36
127 0.34
128 0.35
129 0.37
130 0.4
131 0.46
132 0.44
133 0.42
134 0.36
135 0.33
136 0.32
137 0.31
138 0.28
139 0.21
140 0.22
141 0.22
142 0.21
143 0.21
144 0.21
145 0.18
146 0.14
147 0.13
148 0.13
149 0.16
150 0.2
151 0.23
152 0.29
153 0.37
154 0.41
155 0.47
156 0.48
157 0.48
158 0.45
159 0.42
160 0.37
161 0.33
162 0.3
163 0.28
164 0.28
165 0.24
166 0.24
167 0.23
168 0.2
169 0.21
170 0.18
171 0.13
172 0.12
173 0.11
174 0.1
175 0.1
176 0.11
177 0.09
178 0.11
179 0.12
180 0.14
181 0.15
182 0.14
183 0.14
184 0.15
185 0.17
186 0.14
187 0.15
188 0.17
189 0.2
190 0.26
191 0.28
192 0.33
193 0.37
194 0.4
195 0.43
196 0.46
197 0.53
198 0.56
199 0.61
200 0.63
201 0.59
202 0.64
203 0.65
204 0.65
205 0.58
206 0.53
207 0.47
208 0.4
209 0.37
210 0.3
211 0.31
212 0.25
213 0.22
214 0.2
215 0.19
216 0.21
217 0.25
218 0.25
219 0.26
220 0.27
221 0.29
222 0.31
223 0.32
224 0.31
225 0.27
226 0.33
227 0.29
228 0.28
229 0.26
230 0.23
231 0.22
232 0.19
233 0.18
234 0.12
235 0.12
236 0.1
237 0.09
238 0.07
239 0.08
240 0.08
241 0.09
242 0.09
243 0.07
244 0.06
245 0.06
246 0.06
247 0.05
248 0.05
249 0.06
250 0.07
251 0.09
252 0.1
253 0.14
254 0.18
255 0.19
256 0.25
257 0.27
258 0.32
259 0.35
260 0.4
261 0.41
262 0.39
263 0.42
264 0.38
265 0.37
266 0.32
267 0.3
268 0.27
269 0.22
270 0.26
271 0.25
272 0.26
273 0.29
274 0.34
275 0.4
276 0.47
277 0.52
278 0.57
279 0.62
280 0.67
281 0.73
282 0.78
283 0.76
284 0.71
285 0.71
286 0.71
287 0.67
288 0.62
289 0.52
290 0.42
291 0.35
292 0.32
293 0.26
294 0.17
295 0.12
296 0.09
297 0.09
298 0.1
299 0.1
300 0.11
301 0.13
302 0.18
303 0.21
304 0.23
305 0.25
306 0.25
307 0.3
308 0.37
309 0.43
310 0.4
311 0.39
312 0.38
313 0.39
314 0.39
315 0.4
316 0.38
317 0.36
318 0.37
319 0.42
320 0.46
321 0.51
322 0.58
323 0.59
324 0.62
325 0.65
326 0.69
327 0.72
328 0.78
329 0.77
330 0.79
331 0.78
332 0.73
333 0.7
334 0.69
335 0.59
336 0.49
337 0.45
338 0.35
339 0.28
340 0.23
341 0.17
342 0.14
343 0.13
344 0.12
345 0.13
346 0.14
347 0.15
348 0.17
349 0.21
350 0.26
351 0.31
352 0.34
353 0.37
354 0.42
355 0.5
356 0.55
357 0.6
358 0.6
359 0.61
360 0.62
361 0.61