Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AYE0

Protein Details
Accession D4AYE0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-55AEEGKERKERKKEEEKKKKKVGKLKKKKRRRRKSKSRKGLKEGGGGBasic
NLS Segment(s)
PositionSequence
4-52RRSRGEAEEGKERKERKKEEEKKKKKVGKLKKKKRRRRKSKSRKGLKEG
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG abe:ARB_01209  -  
Amino Acid Sequences MKSRRSRGEAEEGKERKERKKEEEKKKKKVGKLKKKKRRRRKSKSRKGLKEGGGGAWPVEDLVKDLVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.53
4 0.56
5 0.57
6 0.57
7 0.66
8 0.73
9 0.78
10 0.85
11 0.87
12 0.88
13 0.91
14 0.89
15 0.85
16 0.85
17 0.85
18 0.85
19 0.86
20 0.87
21 0.87
22 0.91
23 0.94
24 0.95
25 0.95
26 0.95
27 0.95
28 0.95
29 0.96
30 0.97
31 0.97
32 0.96
33 0.95
34 0.91
35 0.89
36 0.82
37 0.77
38 0.67
39 0.57
40 0.48
41 0.38
42 0.3
43 0.21
44 0.16
45 0.09
46 0.08
47 0.06
48 0.07
49 0.1