Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AWR3

Protein Details
Accession D4AWR3    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
34-63SLAYLPRKRAARHRGKVKSFPKDDPKKPVHBasic
132-160SDEVKRRFYKNWYKSKKKAFTRYAKTHADHydrophilic
NLS Segment(s)
PositionSequence
40-60RKRAARHRGKVKSFPKDDPKK
256-264KKLPRKTHK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR019926  Ribosomal_L3_CS  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abe:ARB_00629  -  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
PROSITE View protein in PROSITE  
PS00474  RIBOSOMAL_L3  
Amino Acid Sequences MAAAGVTENTKPRGTLKREKLEVEDDETDDETGSLAYLPRKRAARHRGKVKSFPKDDPKKPVHLTATMGYKAGMTTIVRDLERPGAKMHRKEIVEAVTIVETPPMIAVGIVGYIETPRGLRSLTTVWADHLSDEVKRRFYKNWYKSKKKAFTRYAKTHADAASTTRELERIKNYCTVVRLLAHTQIRKTPLKQKKAHLMEIQVNGGSIADKVEFAHGLFEKPIDVDSVFEKDEVVDVIAVTKGHGFSGVTSRWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQDGYHHRTSANHKIYRIGKADDEGNASTDFDVSKKRITPMGGFVRYGEVKNDYVMLKGSIPGVRKRVVTLRKTLWPQVSRKATEKVDLKWIDTSSKFGHGAYQTPAEKRAFLGTLKKDLASSSARRALSSRLSLPSLSLRLALRHQYRQYRQYQQYQLRQLSKMSSDSAYAAFLDKANQGLDSTAATATDKADKKDDQDSGFIASKTLDVDEQRVPPSLRVDAFYSSETDEPFEPVVLALDHLPSEGIPSLSLSLSLLYFYDFYLAIEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.58
4 0.65
5 0.69
6 0.72
7 0.7
8 0.67
9 0.61
10 0.57
11 0.5
12 0.4
13 0.37
14 0.35
15 0.29
16 0.23
17 0.19
18 0.12
19 0.09
20 0.08
21 0.07
22 0.09
23 0.15
24 0.2
25 0.24
26 0.3
27 0.36
28 0.41
29 0.5
30 0.59
31 0.64
32 0.69
33 0.76
34 0.81
35 0.83
36 0.89
37 0.88
38 0.88
39 0.83
40 0.82
41 0.82
42 0.82
43 0.81
44 0.81
45 0.77
46 0.76
47 0.73
48 0.72
49 0.65
50 0.58
51 0.55
52 0.49
53 0.49
54 0.41
55 0.38
56 0.3
57 0.25
58 0.21
59 0.18
60 0.15
61 0.09
62 0.11
63 0.14
64 0.17
65 0.17
66 0.18
67 0.2
68 0.26
69 0.28
70 0.26
71 0.27
72 0.34
73 0.42
74 0.46
75 0.49
76 0.48
77 0.47
78 0.48
79 0.49
80 0.43
81 0.38
82 0.32
83 0.29
84 0.22
85 0.21
86 0.18
87 0.13
88 0.09
89 0.07
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.07
108 0.11
109 0.13
110 0.16
111 0.18
112 0.18
113 0.19
114 0.21
115 0.21
116 0.17
117 0.16
118 0.14
119 0.14
120 0.21
121 0.23
122 0.27
123 0.3
124 0.33
125 0.36
126 0.45
127 0.53
128 0.56
129 0.64
130 0.69
131 0.76
132 0.82
133 0.88
134 0.88
135 0.87
136 0.87
137 0.86
138 0.86
139 0.86
140 0.86
141 0.83
142 0.78
143 0.7
144 0.64
145 0.55
146 0.46
147 0.36
148 0.3
149 0.27
150 0.22
151 0.21
152 0.16
153 0.18
154 0.18
155 0.21
156 0.27
157 0.25
158 0.27
159 0.32
160 0.33
161 0.32
162 0.33
163 0.3
164 0.25
165 0.23
166 0.23
167 0.2
168 0.25
169 0.27
170 0.27
171 0.27
172 0.29
173 0.33
174 0.34
175 0.37
176 0.42
177 0.46
178 0.54
179 0.59
180 0.62
181 0.67
182 0.69
183 0.71
184 0.63
185 0.59
186 0.55
187 0.51
188 0.45
189 0.34
190 0.28
191 0.21
192 0.18
193 0.13
194 0.06
195 0.05
196 0.04
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.09
203 0.09
204 0.09
205 0.1
206 0.09
207 0.09
208 0.09
209 0.09
210 0.07
211 0.06
212 0.06
213 0.07
214 0.1
215 0.1
216 0.09
217 0.09
218 0.08
219 0.08
220 0.08
221 0.06
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.06
232 0.05
233 0.05
234 0.1
235 0.11
236 0.12
237 0.12
238 0.14
239 0.15
240 0.17
241 0.19
242 0.22
243 0.32
244 0.39
245 0.49
246 0.54
247 0.62
248 0.69
249 0.76
250 0.77
251 0.77
252 0.76
253 0.71
254 0.7
255 0.64
256 0.55
257 0.47
258 0.39
259 0.31
260 0.28
261 0.23
262 0.18
263 0.16
264 0.16
265 0.16
266 0.15
267 0.16
268 0.1
269 0.12
270 0.12
271 0.13
272 0.13
273 0.11
274 0.11
275 0.11
276 0.14
277 0.16
278 0.2
279 0.2
280 0.2
281 0.19
282 0.23
283 0.28
284 0.35
285 0.4
286 0.36
287 0.36
288 0.42
289 0.45
290 0.47
291 0.44
292 0.35
293 0.27
294 0.26
295 0.27
296 0.21
297 0.21
298 0.15
299 0.14
300 0.12
301 0.12
302 0.1
303 0.09
304 0.08
305 0.07
306 0.1
307 0.1
308 0.12
309 0.14
310 0.16
311 0.18
312 0.2
313 0.21
314 0.26
315 0.33
316 0.32
317 0.3
318 0.29
319 0.29
320 0.29
321 0.27
322 0.2
323 0.15
324 0.13
325 0.14
326 0.15
327 0.12
328 0.12
329 0.12
330 0.11
331 0.09
332 0.09
333 0.11
334 0.12
335 0.14
336 0.17
337 0.2
338 0.22
339 0.22
340 0.24
341 0.3
342 0.36
343 0.37
344 0.41
345 0.41
346 0.46
347 0.49
348 0.52
349 0.51
350 0.48
351 0.48
352 0.51
353 0.53
354 0.5
355 0.51
356 0.51
357 0.45
358 0.46
359 0.46
360 0.39
361 0.42
362 0.4
363 0.37
364 0.34
365 0.34
366 0.31
367 0.27
368 0.29
369 0.21
370 0.24
371 0.23
372 0.2
373 0.23
374 0.2
375 0.23
376 0.21
377 0.26
378 0.25
379 0.25
380 0.3
381 0.25
382 0.25
383 0.23
384 0.23
385 0.19
386 0.19
387 0.26
388 0.25
389 0.3
390 0.31
391 0.3
392 0.27
393 0.26
394 0.28
395 0.25
396 0.25
397 0.25
398 0.31
399 0.31
400 0.32
401 0.33
402 0.33
403 0.33
404 0.34
405 0.32
406 0.28
407 0.29
408 0.28
409 0.29
410 0.28
411 0.24
412 0.2
413 0.2
414 0.17
415 0.18
416 0.22
417 0.28
418 0.3
419 0.36
420 0.42
421 0.49
422 0.55
423 0.61
424 0.66
425 0.68
426 0.7
427 0.72
428 0.75
429 0.75
430 0.77
431 0.77
432 0.77
433 0.71
434 0.65
435 0.58
436 0.51
437 0.45
438 0.38
439 0.32
440 0.25
441 0.21
442 0.21
443 0.2
444 0.17
445 0.14
446 0.13
447 0.12
448 0.11
449 0.12
450 0.12
451 0.12
452 0.12
453 0.12
454 0.11
455 0.1
456 0.11
457 0.09
458 0.1
459 0.08
460 0.08
461 0.09
462 0.09
463 0.1
464 0.18
465 0.2
466 0.21
467 0.27
468 0.28
469 0.31
470 0.38
471 0.41
472 0.35
473 0.35
474 0.34
475 0.34
476 0.35
477 0.32
478 0.25
479 0.2
480 0.18
481 0.17
482 0.17
483 0.15
484 0.12
485 0.16
486 0.21
487 0.24
488 0.25
489 0.29
490 0.29
491 0.29
492 0.31
493 0.32
494 0.29
495 0.28
496 0.29
497 0.28
498 0.29
499 0.27
500 0.25
501 0.22
502 0.23
503 0.21
504 0.2
505 0.18
506 0.18
507 0.17
508 0.16
509 0.13
510 0.12
511 0.13
512 0.1
513 0.11
514 0.09
515 0.09
516 0.09
517 0.09
518 0.09
519 0.07
520 0.1
521 0.11
522 0.1
523 0.1
524 0.11
525 0.12
526 0.12
527 0.13
528 0.1
529 0.1
530 0.09
531 0.09
532 0.08
533 0.08
534 0.09
535 0.08
536 0.1
537 0.09