Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4B0K6

Protein Details
Accession D4B0K6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-46TPKVEPQEKKKTPKGRAKKRLQYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abe:ARB_01981  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRLQYTRRFVNVTMTGGKRKVRFIHLKMMDFSRAQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.47
4 0.47
5 0.49
6 0.58
7 0.61
8 0.66
9 0.66
10 0.68
11 0.71
12 0.73
13 0.76
14 0.75
15 0.76
16 0.76
17 0.8
18 0.81
19 0.81
20 0.84
21 0.87
22 0.87
23 0.88
24 0.89
25 0.86
26 0.85
27 0.81
28 0.79
29 0.74
30 0.67
31 0.57
32 0.54
33 0.48
34 0.41
35 0.39
36 0.32
37 0.31
38 0.32
39 0.37
40 0.32
41 0.35
42 0.37
43 0.41
44 0.48
45 0.49
46 0.56
47 0.58
48 0.6
49 0.57
50 0.56
51 0.51