Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AMI5

Protein Details
Accession D4AMI5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-99VKLQGKKKSARAKEKKKARKKAKKRKKRKKRRASGEQEEKEEKBasic
NLS Segment(s)
PositionSequence
52-91GGKRAVKLQGKKKSARAKEKKKARKKAKKRKKRKKRRASG
Subcellular Location(s) cyto 18, cyto_nucl 13.833, nucl 7.5, mito_nucl 5.166
Family & Domain DBs
KEGG abe:ARB_05438  -  
Amino Acid Sequences MGGGAGVGVFGGVWWVVEDGEVGGWRLEVEGEEEEEEEEKREDGEKRQNDEGGKRAVKLQGKKKSARAKEKKKARKKAKKRKKRKKRRASGEQEEKEEKEGKSQPFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.07
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.07
28 0.1
29 0.12
30 0.17
31 0.26
32 0.29
33 0.33
34 0.35
35 0.37
36 0.36
37 0.36
38 0.35
39 0.31
40 0.27
41 0.23
42 0.23
43 0.26
44 0.29
45 0.34
46 0.4
47 0.43
48 0.49
49 0.53
50 0.59
51 0.64
52 0.68
53 0.72
54 0.74
55 0.75
56 0.79
57 0.86
58 0.89
59 0.9
60 0.92
61 0.92
62 0.92
63 0.93
64 0.94
65 0.95
66 0.95
67 0.96
68 0.97
69 0.97
70 0.97
71 0.97
72 0.97
73 0.97
74 0.97
75 0.96
76 0.96
77 0.95
78 0.95
79 0.89
80 0.85
81 0.78
82 0.68
83 0.61
84 0.56
85 0.45
86 0.42
87 0.43