Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B4P7

Protein Details
Accession D4B4P7   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-103NDWRWIEEKRKGKREKREGKKKAALGABasic
NLS Segment(s)
PositionSequence
85-109KRKGKREKREGKKKAALGAKYKRVK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
KEGG abe:ARB_03437  -  
Amino Acid Sequences MKKRILAAFKIRAEQTKGREVEAGSWARTATVACRKEGDVAESQVKSKSNAKSVGAVEAGAEAVGKKSEKSDSVQMNDWRWIEEKRKGKREKREGKKKAALGAKYKRVKDLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.47
4 0.45
5 0.41
6 0.41
7 0.37
8 0.34
9 0.34
10 0.31
11 0.22
12 0.22
13 0.21
14 0.18
15 0.18
16 0.15
17 0.14
18 0.21
19 0.22
20 0.22
21 0.24
22 0.24
23 0.28
24 0.28
25 0.25
26 0.19
27 0.21
28 0.24
29 0.23
30 0.23
31 0.21
32 0.21
33 0.21
34 0.24
35 0.24
36 0.24
37 0.27
38 0.27
39 0.29
40 0.29
41 0.28
42 0.22
43 0.19
44 0.14
45 0.11
46 0.1
47 0.05
48 0.05
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.06
55 0.08
56 0.1
57 0.14
58 0.21
59 0.24
60 0.28
61 0.34
62 0.36
63 0.36
64 0.39
65 0.36
66 0.3
67 0.28
68 0.29
69 0.29
70 0.34
71 0.41
72 0.47
73 0.57
74 0.66
75 0.72
76 0.79
77 0.84
78 0.87
79 0.89
80 0.91
81 0.89
82 0.9
83 0.9
84 0.82
85 0.8
86 0.77
87 0.72
88 0.71
89 0.72
90 0.71
91 0.71
92 0.68