Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AUK1

Protein Details
Accession D4AUK1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
17-47DGREEEKNKKKTKTKTKTKKRKRDAVPSVAMBasic
NLS Segment(s)
PositionSequence
20-39EEEKNKKKTKTKTKTKKRKR
68-77REKKKRTKAK
Subcellular Location(s) cyto 17.5, cyto_nucl 13, nucl 7.5
Family & Domain DBs
KEGG abe:ARB_07918  -  
Amino Acid Sequences MAAVVVVEEEVKAGGGDGREEEKNKKKTKTKTKTKKRKRDAVPSVAMGNGQLVCKKEEATQNCTEHEREKKKRTKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.11
6 0.14
7 0.17
8 0.24
9 0.32
10 0.41
11 0.47
12 0.54
13 0.59
14 0.68
15 0.77
16 0.8
17 0.82
18 0.84
19 0.89
20 0.92
21 0.94
22 0.95
23 0.93
24 0.92
25 0.89
26 0.89
27 0.86
28 0.82
29 0.74
30 0.64
31 0.55
32 0.45
33 0.37
34 0.25
35 0.18
36 0.11
37 0.08
38 0.09
39 0.09
40 0.11
41 0.11
42 0.13
43 0.16
44 0.24
45 0.28
46 0.33
47 0.4
48 0.41
49 0.43
50 0.44
51 0.42
52 0.41
53 0.47
54 0.51
55 0.54
56 0.62
57 0.69