Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B2G0

Protein Details
Accession D4B2G0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-54VGAKKEKDGKRERKKDGKKTIGHBasic
NLS Segment(s)
PositionSequence
35-52KKEKDGKRERKKDGKKTI
Subcellular Location(s) cyto 25
Family & Domain DBs
KEGG abe:ARB_02688  -  
Amino Acid Sequences MVKTEVLGRDLKMALMKVTEVGEAGVAGVVVVGAKKEKDGKRERKKDGKKTIGHVESRAAGATSNGRGKGWLPIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.11
5 0.11
6 0.1
7 0.08
8 0.07
9 0.07
10 0.06
11 0.05
12 0.04
13 0.03
14 0.03
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.03
22 0.05
23 0.13
24 0.15
25 0.24
26 0.34
27 0.46
28 0.56
29 0.66
30 0.74
31 0.77
32 0.85
33 0.87
34 0.88
35 0.86
36 0.8
37 0.76
38 0.78
39 0.73
40 0.65
41 0.56
42 0.48
43 0.39
44 0.35
45 0.29
46 0.19
47 0.13
48 0.12
49 0.14
50 0.17
51 0.2
52 0.2
53 0.2
54 0.21
55 0.22